SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|246323|gm1.50300019 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|246323|gm1.50300019
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000465
Family Nitrogenase iron protein-like 0.046
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000314
Family DRTGG domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|246323|gm1.50300019
Sequence length 292
Sequence
MRSVFVAATRQHVGKSTTSLGLLAALSSRVPLESIGYLKPVGQQHVEVQAAAEGAPPLRV
DKDCRLAKEYFGLRCEYKHMSPVLMPRGFTKSYVDGEIDMERQKQALLHAWEALRAAHPN
VVVEGTGHMGLLGQRLISGEGHGEEHVLRHCGGVQFVTCSVRRFEERLAEGEYSDRLLVV
HGSRLGILEACLRHHAQTGEIRGGVIFTGTRHSWAPDEPILARLRESRIPTMHAPLETTE
VAERIQKFTAKLNATDRQRTEAAIRHVQAHVDMDVLLGGTAAGGLASPRRGV
Download sequence
Identical sequences R1DU04
jgi|Emihu1|246323|gm1.50300019 XP_005766690.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]