SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|317568|fgenesh_newKGs_pm.1226__1 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|317568|fgenesh_newKGs_pm.1226__1
Domain Number 1 Region: 48-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.94e-35
Family Calponin-homology domain, CH-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|317568|fgenesh_newKGs_pm.1226__1
Sequence length 404
Sequence
MTDHHFMSTRVSTKPVSNAVHAGYDGAAKRDDGIPLYGMDKELADKAAAKFDPKMEREAR
EWIEAVTGEALEGTLQEALKSGVVLCALVNALKPGVCKKPSAMKMAFQQMENIAKYLEAC
SALGVPKHDLFQTVSLYENQDMMAVITNIHSLGRVSGKVPGYGGPTLGAKLADKSVRHFD
EETLRKGRAEQTFLGKGSHGHASQAGTVDTSRNIGKMDKVRGIDGLGTDASVTAVGMGSH
GHASQAGTFDTSRNIGKVDHVKGIGGLGGDGTTTAVGMGSHGHASQAGTFDTSRNIGKAG
TFDTSRNIGKVDHVKGIGGLGGDGTTTAVGMGSHGHASQAGTFDTSRNIGKVDHVKGIGG
LGTDGISQINLGSHGHATQEGMGKMHGTREIVHQTFGGAAAAAA
Download sequence
Identical sequences R1FPZ8
XP_005790150.1.92643 jgi|Emihu1|317568|fgenesh_newKGs_pm.1226__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]