SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1
Domain Number 1 Region: 197-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.75e-17
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Domain Number 2 Region: 48-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000285
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1
Domain Number - Region: 109-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000202
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1
Sequence length 333
Sequence
MSKFCSSCGEPARLCHCKGRPSLPNCTSGSGQAPVGPSPGRASDQRTGLPACKGCGKPVQ
CRTISAMGGAYHPECFKCAGCGGAFVDRAAGFVEHGGCAYHRGCFTAPARACHFCSQPLI
GQAMKAAGAEFHPQCLPRCGTCGVSLEAGWYHDPSTDVRYCAAHAPRAPARGGRRAGSGT
VSAAALRLPRPPAVEQLDMRHMLKWAETAAAQSDPTVHIIDWSRSFADGRAFLAILRTYF
PEAVDASVLASSACAGEGSRLRAPEVRSACAHAFRLADELAGVPQLLDEGDMARNYPLPD
EKSVITYVCTLWGGLARAAERTEGKAGGVSASA
Download sequence
Identical sequences R1EAK2
jgi|Emihu1|373872|fgenesh_newKGs_kg.2831__1__2693091:1 XP_005776169.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]