SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|421444|estExtDG_fgenesh_newKGs_pm.C_270015 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|421444|estExtDG_fgenesh_newKGs_pm.C_270015
Domain Number 1 Region: 108-614
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.66e-128
Family Calponin-homology domain, CH-domain 0.00000000371
Further Details:      
 
Domain Number 2 Region: 36-81
Classification Level Classification E-value
Superfamily EF-hand 0.000000875
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|421444|estExtDG_fgenesh_newKGs_pm.C_270015
Sequence length 619
Sequence
MAQRRARSLTGCVEAGAKHGLSSNASQALSSEDIDVSKLRKLFASLDTDGSGSITAGEMR
SALTKMGADPAAADDEFAKAAQRGAEIVALAKKVQGYGGADARSVHSYAEEECKAFSDFI
NARLADDESLSHLLPIATADGLFSAVSDGMLLCRLLNEAAPGAIDERAVNRISPSKPSRF
HVTENQNLAISAAKGSGIKVVNVGAEDIIEGQPHLILGLVWQMVKMALLSKINLRSNPFL
IRLASLLLLEGETLEDLLKLPPEQLLMRWVNYHLAQSSCSRRLRNFGSDVADSEIYAHLL
QQIDPGRRVSAADVMRLGDKTARAQQVVSAGRRLGSDFSIRPKDIVSANEKLNLAFVAGL
FNACPALEPLDEEELKLFDELEDDDVGDSREERAFRLWINSLGIDGVYVDNLYDGVRDGL
VLLSVMDHVQPGVVEWSKVNRKPGMVFKQVENVNYAIAIGKGEFKFSLVGVAGSDIAVDG
SKKLSLALIWQLMRAHLVSFLATLKSKTPRSTDSAMVRWANETVEAAGYASRMKDFGDKS
LADGLFLLDLLTAVERRCVNRDLLADGATDESRLLNAKYAIACARKLGCALFCLPEDLVE
VRPKMVMSFVASVMAFAGA
Download sequence
Identical sequences R1EUL6
XP_005776963.1.92643 jgi|Emihu1|421444|estExtDG_fgenesh_newKGs_pm.C_270015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]