SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|434223|estExtDG_fgenesh_newKGs_kg.C_170112 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|434223|estExtDG_fgenesh_newKGs_kg.C_170112
Domain Number 1 Region: 48-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-35
Family Calponin-homology domain, CH-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|434223|estExtDG_fgenesh_newKGs_kg.C_170112
Sequence length 391
Sequence
MTDHHFMSTRVPTKPVSNAVHAGYDGAAKREDGIPLYGMDKELADKAAAKFDPKMEREAR
EWIEAVTGEALEGTLQEALKSGVVLCALVNALKPGVCKKPSTMKMAFQQMENIAKYLEAC
SALGVPKHDLFQTVSLYENQDMMAVITNIHSLGRVSGKVPGYGGPTLGAKLADKSVRHFD
EETLRKGRAEQTFLGKGSHGNASQAGTVDTSRNIGKMDKVRGIDGLGTDASVTAVGMGSH
GHASQAGTFDTSRNIGKVDHVKGIGGLGTDASVTAVGMGSHGHASQAGTFDTSKNISKVD
HVKGIDGLGGDGTTTAVGMGSHGHASQAGTFDTSKNIDRTTNIKGIDGLGTDGISQINLG
SHGHATQEGMGKMHGTREIVHQTVGGAVAAA
Download sequence
Identical sequences R1F9N4
jgi|Emihu1|434223|estExtDG_fgenesh_newKGs_kg.C_170112 jgi|Emihu1|445681|estExtDG_fgenesh_newKGs_kg.C_4930005 XP_005767490.1.92643 XP_005784550.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]