SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|446444|estExtDG_fgenesh_newKGs_kg.C_8080001 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|446444|estExtDG_fgenesh_newKGs_kg.C_8080001
Domain Number 1 Region: 124-386
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.23e-63
Family Calponin-homology domain, CH-domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 35-98
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000391
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|446444|estExtDG_fgenesh_newKGs_kg.C_8080001
Sequence length 434
Sequence
MAQRRARSLTGCVEAGAKHGLSSNASQALSSEDIDVSKLRKLFASLDTDGSGSITAGEMR
SALTKMGADPAAADDVIEDSDANGDNKVTFEEFAKAAQRGAEIVALAKKVQGYGGADARS
VHSYAEEECKAFSDFINARLADDESLSHLLPIATADGLFSAVSDGMLLCRLLNEAAPGAI
DERAVNRISPSKPSRFHVTENQNLAISAAKGSGIKVVNVGAEDIIEGQPHLILGLVWQMV
KMALLSKINLRSNPFLIRLLLEGETLEDLLKLPPEQLLMRWVNYHLAQSSCSRRLRNFGS
DVADSEIYAHLLQQIDPGRRVSAADVMRLGDKTARAQQVVSAGRRLGSDFSIRPKDIVSA
NEKLNLAFVAGLFNACPALEPLDEEELKLCSKTTTSATRARSAPSACGSTRWASTACTWT
TCTTASATGSCCSR
Download sequence
Identical sequences jgi|Emihu1|446444|estExtDG_fgenesh_newKGs_kg.C_8080001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]