SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|447276|estExtDG_fgenesh_newKGs_kg.C_50320001 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|447276|estExtDG_fgenesh_newKGs_kg.C_50320001
Domain Number 1 Region: 48-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-35
Family Calponin-homology domain, CH-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|447276|estExtDG_fgenesh_newKGs_kg.C_50320001
Sequence length 317
Sequence
MTDHHFMSTRVPTKPVSNAVHAGYDGAAKREDGIPLYGMDKELADKAAAKFDPKMEREAR
EWIEAVTGEALEGTLQEALKSGVVLCALVNALKPGVCKKPSTMKMAFQQMENIAKYLEAC
SALGVPKHDLFQTVSLYENQDMMAVITNIHSLGRVSGKVPGYGGPTLGAKLADKSVRHFD
EETLRKGRAEQTFLGKGSHGNASQAGTVDTSRNIGKMDKVRGIDGLGTDASVTAVGMGSH
GHASQAGTFDTSRNIGKVDHVKGIGGLGTDASVTAVGMGSHGHASQAGTFDTSKNISKVD
HVKGIDGLGGDGTTTAV
Download sequence
Identical sequences R1DI89
XP_005766679.1.92643 jgi|Emihu1|447276|estExtDG_fgenesh_newKGs_kg.C_50320001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]