SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|448230|estExtDG_Genemark1.C_50562 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|448230|estExtDG_Genemark1.C_50562
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.85e-20
Family Calponin-homology domain, CH-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|448230|estExtDG_Genemark1.C_50562
Sequence length 236
Sequence
MSRSGGTFTDLKNAQTDANGTPLYGIDKELAEKASRALLRAASKYDPALEADCRSWLEAV
TGTALPEGTLHEALKSGVVLCNAVNAIKPGENIANFSTACESLGVPKFSLFQTDMGAVLL
TLQALGSAAQKVRQFTPEQLAAGKASQTFVGRGSTGTSGSMGAHVDNSRNINKMQHVVGE
MGNLGIDGTISAIGAGSHGTPGSKMGANIDHSKDIDKLAQVAGAEVRASKEVKESS
Download sequence
Identical sequences R1E1H8
jgi|Emihu1|448230|estExtDG_Genemark1.C_50562 XP_005767238.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]