SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|454797|estExtDG_Genemark1.C_1210069 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|454797|estExtDG_Genemark1.C_1210069
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.29e-22
Family Calponin-homology domain, CH-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|454797|estExtDG_Genemark1.C_1210069
Sequence length 916
Sequence
MPPKKGLDQEALLRWAKAETSGYPLVQVTNWQSSWNDGLAFCALLHRRFPEDIGSFDALT
NATPEARAANFELAFGVAERRLDVDRLLDVEDMMATYPKPDKKCMVLYAVTLNKAIAEKF
GSASGSGAAPAPAAASKKEAAKAKAAAAKAEKEAEAERARAEKEERIARSRAKAAATKAG
KAREAQEQTASSAASAADRLTRLAGKSGDAPSPSPTGARMPSIAAAARALTWAKKAKGSP
APVKGAVARAALALEGGSPAAERGPGGLAHLRARAAAARSAKARIRAGVKLRKRAPAAPA
KPAGGEGVMSRLQPTAAGTAAAARSDGSAAPSGGSSSASHTGQVRPSLEASRLRERKEKE
KADKIALLKARAAAARVAKARVEEESARRSAGEAAAGEAAPPAVVSPVASRAAPGFLSQI
RTGGFLRSKPSPAPSPSPSPVPSPVGKRAAVSLAVSKKLSAEISNAPPRGSMAERLQAYD
AAEAAQPSTSTPLRPSPDKEGVEVHDRRSVADREAKATDALSEFRAARLSLRTGEPKRGG
AAAAAVAVPPLKVTRIDGVKSAREALEQYLEQMVSASETSDSESGSSSDEGEEEELPPPP
PGGPLWSPSELLGFGGLTAMQFAQADADADGRVTQSELQAMPSPRAELLAALAAPATKTG
RVAASGALTPRLKLQLLRETLAKRRSSSAPGRRPFPGAEGGGGDASAGNASAPGLRAGRG
VASEQENDERNDDIRSEAKAGSGAGDSSERSEGESSQSSESDSSDGDADAEERLGLMGWM
RNVGKVGGKVGKVRLRSASERVAPRPKLAVGAISHLRPGPVDSKRRLSQRLPSFLHELED
AALRRDLETWAGSRKLPGEAVELLLAAGVQDVAEIKHLRGGDALASPPVMEQFPIELRDK
VEQAVQAERYSYATLD
Download sequence
Identical sequences R1FQ93
XP_005790235.1.92643 jgi|Emihu1|454797|estExtDG_Genemark1.C_1210069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]