SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|455078|estExtDG_Genemark1.C_1320045 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|455078|estExtDG_Genemark1.C_1320045
Domain Number 1 Region: 18-174
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.52e-37
Family Calponin-homology domain, CH-domain 0.0008
Further Details:      
 
Domain Number 2 Region: 695-841
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000899
Family Calmodulin-like 0.004
Further Details:      
 
Domain Number 3 Region: 214-335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000101
Family Spectrin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|455078|estExtDG_Genemark1.C_1320045
Sequence length 845
Sequence
MPDENVTEGLSGSKDGEAARQKMQIKSFTAWVNLHLKQAGMAVENLKTDFGDGIKLLRLV
EIISEEELGKYNQNPVSKFQKVENLNIPLKYINSFLKEIGIRNTYSAENIIDEAYRPDLV
QYQKLNKSAKVDNLNHAFDLANDKLEIPKLLDATDMVSMRPDEKSVMTYVSFFWKSVMTY
VSFFWKVFAANKRKKIAAERITNVLQRELAYRDLMEQYKLNGEQLGRWIKLKTDFFQAEP
NCNSQAELEVEMKKHVMEYGRGETPTTLAGGEKPTKLNELNDLEALHSSITSRLASLGRT
FIPTEDTSLKVLNRWWEELTYAEQAYEANLRLKLKNLKRVEYYIKLHHSKASKLEDWLGD
KERWLGKPADAAANGAAAAPPADADETPPAGPVPRKSSFVGMLKSTGSSFGNQVASPPTP
KGQRASKGVKVVPLHDGPSESVADVQAKLNMLTAHNEELSGRQATVPELDKLLAKIGELG
CPPMRQFSLTNRTSVIKERQVAEIDGYRESLEALQCDLDAIAAYAEEMGSMRISRNPYSR
FGMPDLLAHMSRCEAALEARQVSVQEALAHQQQIDATKKAFAAAADAILEFVKAERAQLD
EVAPPGLVIQPDDTAAIEKGKAMGSALDALMAPDAKEGRDAKLLPAQELSDKLMEAAELD
NPYTAQTIMTLKTQIDLLDKVLRDKRSFVEGQLARAQAEITSEQYEEIKKVFYHFDKSKD
GLLNQLEFAAAIKAMDFEIADHEQEPTFLRFAKEGQRAEEPAAMTIDLSGFTTFVLQQYK
DNDTKDTLFAAFETVANGKDTLSAEDIRAAIPQEEADYLLSQLELKDGDHGLEYKKFTEA
IYGGT
Download sequence
Identical sequences R1DLJ1
jgi|Emihu1|455078|estExtDG_Genemark1.C_1320045 XP_005788802.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]