SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|462452|estExtDG_fgeneshEH_pg.C_140128 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|462452|estExtDG_fgeneshEH_pg.C_140128
Domain Number 1 Region: 26-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-58
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 542-662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000403
Family Spectrin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Emihu1|462452|estExtDG_fgeneshEH_pg.C_140128
Domain Number - Region: 420-531
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000348
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number - Region: 800-904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|462452|estExtDG_fgeneshEH_pg.C_140128
Sequence length 1477
Sequence
MGVFGKKSTPAGTTAEDADFASKAASMREAQDAQQLKTFTRWWNSVLKPRGVKIEDLVVE
VSPGVNPIMLYEELSGTLVKKYSKKPPSRFQKLENQNIFLKALKEKGIRLVNIGAEDLVD
SNRTLICGLTWTLILRYEIQKYGANESELLRWVKACTAGYKGVNITTWGDSFNDGLAFCA
LLHKHDENVLNYDKNSDPKKALGNLDTAFTAAEKRWDVPRLLEPEELAGPDPTDEKSVIT
YVAKLRQAFLDREAEMMRKLKEEEEARKKAEREARQAALKKMVQDLKTGVDDWNKWTKGK
EGDFRKKEGEAPSYPEERCEKELEGLKKFRTEKGKDDKPPKAEEKARLADLYNKVRGEIM
ADAMDAAKEGYQPVFDEGEIADCAPEVLGGKWKDMEKAERDFEDALGRRLADLDAAKRAK
ETDDLLKGLKDKADELMDWLKGKKGDMDGDARSIGDEDDIAKKQAKLDKLLSDEKPPKLD
ETGELAKELHAVADRLAAEGRDPPPDLEGKLQGGWNAFDDAAAALQKALDDARKKAARDK
AMAETDKLQKENEDDANKWLDKVNDKAKDFEDKVKSGDLGNTKEEAEKKLADLRSPFQSD
TKPEWGKERGGIDAGRRAVDDRRKDEDRPPADWKPPGDDLDKGWKRLGDAEREYEKALLD
KLGKLDAEEQERLKKAARKEKALADIADELPPLVQRRKVEKDAAAAAAEAAQKAADIADW
AQKETAALQEQLAALEGDKVSPAEPPLAALEKFCNGDKTAKQGDLLDARAAACDAIATRQ
LQRAGAGGPADAAIAESLPKAEEAWAAMEEAERRLKHALQDKIKRAQGANLEWERLKRGC
TRVAEWLAASTPERMRSELGGTEAEVTALLEEARAVSAALGLQIASVAILTPLAERLFKD
EEYAERAKAAIGTVDMLPSLAAPMAERVARLEEELERQRRLTAERRAFSEATGALEASIV
EAEELVGFPVDTVDTAEIIKALREVGDKQESDLLPAPEAAEPDAIKRAEAACATWRQLSS
MMPPRAAACEAAHRAALAAEKLQCDYREAAEAFRKWHAGAVALLTMPAGDDARAADDVRK
AAEIAIEQLPVGEAHHRAAKVASDKMASYSIAQNPSVLTLAQMSAALTQMRSLLSLLQGA
AKLAPGNATLPTKKIVAALEDLAEATGVSPASLGSEFGLPDEHVKFLEDEMEKKNGALQP
TSFDPFPADRSAVPTLSLPTIPLDLRAHGLAVIEHVNKARKEPENHADTLEAALSDAYEG
NHLTCPPSWGGKKLVTAEGVGALRDLLKALRKATGNLPTLRLVAALDDAAQQAAEELAAG
KSPTDLTTRLSSRGTFSGSAGEAIVYGVRQPEPIAAQLLLSDGDAQRRNRSFLMNGDLKV
AGFGLADHPQHGSVCVIVCTSLFATPIDKPMTVECQGEANDDFQRVLDAIPSEQARDIAT
DALVVGKKVKLDYVPGSIDITVYERDGSARTSSLKWA
Download sequence
Identical sequences R1FPX2
XP_005787878.1.92643 jgi|Emihu1|462452|estExtDG_fgeneshEH_pg.C_140128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]