SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|57427|gw1.129.30.1 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|57427|gw1.129.30.1
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.27e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00093
Further Details:      
 
Domain Number 2 Region: 89-118
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 0.00000000051
Family CO dehydrogenase ISP C-domain like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|57427|gw1.129.30.1
Sequence length 118
Sequence
ELVFSLNGRERRLVDPPPSLTLAEWLRSEGLTGTKIGCAEGGCGACTVIAVGSDGHPRAI
NACLRLLCGCDGLALTTVEGLGSQGAGYSQVMKAIAEGQGSQCGFCTPGWVTAMSALL
Download sequence
Identical sequences R1BZD4
jgi|Emihu1|57422|gw1.47.57.1 jgi|Emihu1|57427|gw1.129.30.1 XP_005768052.1.92643 XP_005789479.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]