SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|99383|fgeneshEH_pg.18__181 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|99383|fgeneshEH_pg.18__181
Domain Number 1 Region: 186-301
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.59e-17
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Domain Number 2 Region: 35-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000218
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  jgi|Emihu1|99383|fgeneshEH_pg.18__181
Domain Number - Region: 98-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00019
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|99383|fgeneshEH_pg.18__181
Sequence length 322
Sequence
MSKFCSSCGEPARLCHCKGRPSLPNCTSGSASDQRTGLPACKGCGKPVQGRTISAMGGAY
HPECFKCAGCGGAFVDRAAGFVEHGGCAYHRGCFTAPARACHFCSQPLIGQAMKAAGAEF
HPQCLPRCGTCGVSLEAGWYHDPSTDVRYCAAHAPRAPARGGRRAGSGTVSAAALRLPRP
PAVEQLDMRHMLKWAETAAAQSDPTVHIIDWSRSFADGRAFLAILRTYFPEAVDASVLAS
SACAGEGSRLRAPEVRSACAHAFRLADELAGVPQLLDEGDMARNYPLPDEKSVITYVCTL
WGGLARAAERTEGKAGGVSASA
Download sequence
Identical sequences R1EX28
XP_005783589.1.92643 jgi|Emihu1|99383|fgeneshEH_pg.18__181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]