SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|113911|fgeneshEH_pg.202__24 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|113911|fgeneshEH_pg.202__24
Domain Number 1 Region: 693-801
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000041
Family cAMP-binding domain 0.018
Further Details:      
 
Domain Number 2 Region: 501-593
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000186
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|113911|fgeneshEH_pg.202__24
Sequence length 1387
Sequence
MKASDSGAAPLPLLLALAKGLPSAAFLTLYHNIDAASFGLLIVPAAADLPISSGIPIYLL
SVVAGQVGFLLASRFSSACGGATIELVPLLAPLASCVGIDQSGLSSRTARASTLLALLSC
TSLLIAIAYFVIARFKLGRLLRCIPLIVLKAALTGVGVYMVVEAIKMGVAWKEEGGMSEG
ETTVFLTETARAGSQLFGPPARPLLLATLLTLAGYIIVKKLGFSQSQSLGYLAAVAIAIN
ALTLGGVCCSAAPGVRDPGWYFGGDEEGEAQASALGLLAEFRPSEVSLPVLATALPYMLS
CVAMHAIVAVTDMVSLEAIASSSGDGPAVTLDLNHEIGATAVANLLAAAVGAMPNYLQLT
PSLICFRLAGSSGSRAGPLIAVFTAASLWAVSPIVSVLPRCVVAAFMLEMGIDFVLETGI
RTFTVTTDPVDQVLIIIVPTVMLLGGFLPGIRIGLLVALANFVVKYSAAPIVRFQQTGGV
LRSNTVRPREHQLVLDERASHSISIISLQGFVMFGSAPQLSDALDNCLARRARCPAQHLH
TPPWFVIVDARAVKGCDFGALQDLEKMRKAVVAEGGIFRVAQPPPPVAHAIERALEGSMG
ELASFNATLHMAEDAVIAAHAAPMTQAHRESLGATAARAFLRSTNPEARKRDVEANSTPP
TAGGPGLDTTRVGNHEAVLNVLTSHTPQVESTHVAHAEALLSLGKTRAVAAGEQLWGVTD
QPSFWVVVLEGQLETRRHGYTIEELVAGSACGFLFLLVKGRQRETDLVAVQASRALLVTA
EAMGTIESAHPALYKTLVDAFVAKAAAEYRHWIRHTSVLEARTADADVSQAANVEVDRLS
PAQLCAIIEAQAGASAAALRVAEEHAARLVEQPEWVLSEALANGFEAVADTSTHIGMVEF
EQMYALPERNLTDLNGIEQLCDCVDAREAAGDNAEELLRALQLERGIELHEDVVELALLR
RQLRIPKEKRRAAMVAAGMIRQHDAMNGVAGVARRGIRAGAREGAAGAQTKVREFHHQRS
ASQGKERYQKLLDEAPAEAASVTNKLYLELAGYSVYQEAIEDAAACASCDPSRKQRPFTG
ERLAYDIDKVLDRHALCPASSSAKIACVFGQAEIQAMIRRRSSDFGTYTQKKAAREGNAA
CRACYSRWECAHDAWAAAHGTWEAARDAAQAARGEFLDPEPGRPSPPAGTPQTHSFLMDV
GDKAELRAGAGRSLLGALESCDVGRGVAEYLTVIGRDQLPFNNEVRPRAKSSSERYGAQQ
GKPNVVGKILNRITNKNYGDKTCNKSTRVRLAALARRRREEEGEEEGEEEGGGGEEAEAD
DCDEDEWLLCYGYYISLCYDGPWCGHELVVSRLNDTDPAAKRAAAKWLEILRSGPLHKYS
YFRGSRE
Download sequence
Identical sequences R1F1H7
XP_005781455.1.92643 jgi|Emihu1|113911|fgeneshEH_pg.202__24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]