SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|197559|gm1.500738 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|197559|gm1.500738
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000195
Family Calponin-homology domain, CH-domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|197559|gm1.500738
Sequence length 100
Sequence
MSAELLRGWLNDDVGLSRQVGSFEDDLANGYLIGELLHRHAVMTDSAFGGFKDQQAGAAI
AKIQNFRQVQQALVDLGVTFDSRLANAEGLFPGIHTMFLR
Download sequence
Identical sequences R1E1T8
XP_005767338.1.92643 jgi|Emihu1|197559|gm1.500738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]