SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|211646|gm1.4800251 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|211646|gm1.4800251
Domain Number 1 Region: 536-623
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000163
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|211646|gm1.4800251
Sequence length 901
Sequence
MLPGSMKEPLVSKGETTVVKSKLWFGYLPLWQETVPLHPNGKIDTVRLIANIMAGLIIGI
RQTLSAIVSATLVFTTTSNQTVVDMFPFGISMMWWSTVAGTVWYGIFGRLQYNTSATQEV
CAILYGAMAGKAATFLEDTPDKIPPTVLALIVTGTILTGFGTVAFGKLGIGKMMLSFPTP
VTNGFLGTIGFFLVKQALQITSGVKFVHFYPISFSAFFAMRSVLPLLCLFAMVMVMRKGP
RLLGSAFPKSKAVKKLGGLFCQLSPLFVFYIVIGIGRMDLDTLGEAGWVYPAQAPQSFTT
LWTTYKLSDADWGVVAACVPDFGSLVLMSALCTMTGVLGITGKFPTGPDGDPAPDEGADF
DMELATVGVGAVFTGLTNGVVTFHRLGSSIQIRMDGGTHRIAVFSSAAFVGVFFFSGIPL
GHYIPKFFLGGLFMSSGVSFMESVIFSYQSMASSGLTLFGSDVPTWEYFGSLLCIATAAY
TSPLGGIAAGLLVSVLSFLASSSSSTPVSSVSDGRFTMGRTFRPIWELKALRTYGDRIAI
LYLQGQLFFGSGQRLASLIAEAVESRHHLSYCILSFAKVSGMDVSAVDFLRSVQRKVARK
GCKLIFCRMEKEVFSALSAAKLINSPSKELRDVIAGTVEQPRAMSIPNAIPEDEEFVDQE
DVHDIGLGHRKTQILMLRKDVTFEPLEPFGQGNDDAFDHETDALDFCAEKVVKEVVYFQG
AKLDPQLLQFRAACETGTRITESTFESLNSLPKGLMAEIKPSCKVLKDKTSVYFIFKGAV
SMVDSIQLNKAREGSSLAFTLNVGVKGFHGRGGKRLRKRYPPGTVVGKMAFALNRTGRML
DDGVQSELVVSSRQAYGTTAELWELTAESWDSLSEEIQNALRDLLIVQQAEERQHTFLCG
E
Download sequence
Identical sequences R1E3A9
XP_005767858.1.92643 jgi|Emihu1|211646|gm1.4800251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]