SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|253018|gm1.153200001 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|253018|gm1.153200001
Domain Number 1 Region: 445-532
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000141
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|253018|gm1.153200001
Sequence length 810
Sequence
MMWWSTVAGTVWYGIFGRLQYNTSATQEVCAILYGAMAGKAATFLEDTPDKIPPTVLALI
VTGTILTGFGTVAFGKLGIGKMMLSFPTPVTNGFLGTIGFFLVKQALQITSGVKFVHFYP
ISFSAFFAMRSVLPLLCLFAMVMVMRKGPRLLGSAFPKSKAVKKLGGLFCQLSPLFVFYI
VIGIGRMDLDTLGEAGWVYPAQAPQSFTTLWTTYKLSDADWGVVAACVPDFGSLVLMSAL
CTMTGVLGITGKFPTGPDGDPAPDEGADFDMELATVGVGAVFTGLTNGVVTFHRLGSSIQ
IRMDGGTHRIAVFSSAAFVGVFFFSGIPLGHYIPKFFLGGLFMSSGVSFMESVIFSYQSM
ASSGLTLFGSDVPTWEYFGSLLCIATAAYTSPLGGIAAGLLVSVLSFLASSSSSTPVSSV
SDGRFTMGRTFRPIWELKALRTYGDRIAILYLQGQLFFGSGQRLASLIAEAVESRHHLSY
CILSFAKVSGMDVSAVDFLRSVQRKVARKGCKLIFCRMEKEVFSALSAAKLINSPSKELR
DVIAGTVEQPRAMSIPNAIPEDEEFVDQEDVHDIGLGHRKTQILMLRKDVTFEPLEPFGQ
GNDDAFDHETDALDFCAEKVVKEVVYFQGAKLDPQLLQFRAACETGTRITESTFESLNSL
PKGLMAEIKPSCKVLKDKTSVYFIFKGAVSMVDSIQLNKAREGSSLAFTLNVGVKGFHGR
GGKRLRKRYPPGTVVGKMAFALNRTGRMLDDGVQSELVVSSRQAYGTTAELWELTAESWD
SLSEEIQNALRDLLIVQQAEERQHTFLCGE
Download sequence
Identical sequences R1FE88
jgi|Emihu1|253018|gm1.153200001 XP_005786240.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]