SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|258642|gm1.796400001 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|258642|gm1.796400001
Domain Number 1 Region: 30-98
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000378
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|258642|gm1.796400001
Sequence length 98
Sequence
MTDTSWTTKTAAAQDTRPVSSAVHTGYDAAEKTEDGIPLYGMDKELAAKAAAKRDPKKEQ
EAREWIEALTGMSLDGTLQEALKSGIVLCALATAIKPG
Download sequence
Identical sequences R1DF33
jgi|Emihu1|258642|gm1.796400001 XP_005759808.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]