SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|415062|estExtDG_Genewise1.C_140024 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|415062|estExtDG_Genewise1.C_140024
Domain Number 1 Region: 136-260
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.66e-34
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 33-134
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.27e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|415062|estExtDG_Genewise1.C_140024
Sequence length 263
Sequence
MMNAAGRSLLRRPQTAAATLSGSRRALATAPKMKSFSIYRWNPDEPNSKPHMQEYSINMN
ECGPMVLDALIKIKNELDPTLTFRRSCREGICGSCAMNINGSNTLACLCKIDTNPSTAIY
PLPHMYVLKDLVPDLTHFYEQHKSVQPYLINDDITDVEHYQSKEDRSKLDGLYECVLCAC
CTTSCPSYWWNTDKYLGPAVLLQSYRWLADSRDTMKAERLKFLDDAFKVYRCHTIMNCSK
TCPKHLNPGKAIAQIKLEMAASH
Download sequence
Identical sequences R1F8P8
jgi|Emihu1|415062|estExtDG_Genewise1.C_140024 XP_005787774.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]