SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|430761|estExtDG_Genewise1Plus.C_3810009 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|430761|estExtDG_Genewise1Plus.C_3810009
Domain Number 1 Region: 130-225
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.02e-29
Family 2Fe-2S ferredoxin-related 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|430761|estExtDG_Genewise1Plus.C_3810009
Sequence length 226
Sequence
MLANHGPGGGDVWWRVSELVKLESADAASTLLEETSPCGQVMRALGSAVVDGGRVDLLAC
SFYKDEKGKQVLAAIEEMTKTNFAASSNVTGNPALADREGHEGDWVLESDKVDIKSVYFE
PDRLMKEFQGCFFSVTLKTPDGSSTIDCPDDTYILDKAEEDGIELPYSCRAGACSSCAGK
VIEGTIDQSDGAFLDDDQMGQGFCLTCVTYPTSDCTIATHQEDELF
Download sequence
Identical sequences R1C925
XP_005771587.1.92643 jgi|Emihu1|430761|estExtDG_Genewise1Plus.C_3810009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]