SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|438902|estExtDG_fgenesh_newKGs_kg.C_880043 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|438902|estExtDG_fgenesh_newKGs_kg.C_880043
Domain Number 1 Region: 51-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-34
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|438902|estExtDG_fgenesh_newKGs_kg.C_880043
Sequence length 362
Sequence
MTDTSWTTKTAAAQDTRPVSSAVHTGYDAAEKTEDGIPLYGMDKELAAKAAAKRDPKKEQ
EARGWIEALTGMSLDGTLQEALKSGIVLCALATAIKPGVCKKASTMAMPFKQMENISNFL
DACTKLGVGKHDLFQTVNLYENKDMNSVLLTLEALGRVASKMPDYKQEWPTFGAKLADKS
VRHFDNETLAKGKAAQTFIGRGSTGQANQSGMVDTSRNIGKMDQVKGIDGLGGDGTATMV
GMGSHGHASQAGTYDTSKNIDKTAHVKGTEGLGGDGTATMVGMGSHGHASQAGTFDTSKD
IDKMKNVKGDGVDELGKEGISAINLGSTGLASQSGMYDTSKDIDKMKNVVQETHGGGVPP
AA
Download sequence
Identical sequences R1B959
jgi|Emihu1|438902|estExtDG_fgenesh_newKGs_kg.C_880043 XP_005758221.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]