SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|448706|estExtDG_Genemark1.C_100085 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|448706|estExtDG_Genemark1.C_100085
Domain Number 1 Region: 166-277
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000334
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Emihu1|448706|estExtDG_Genemark1.C_100085
Domain Number - Region: 327-431
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000363
Family cAMP-binding domain 0.02
Further Details:      
 
Domain Number - Region: 567-679
Classification Level Classification E-value
Superfamily Tropomyosin 0.000512
Family Tropomyosin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|448706|estExtDG_Genemark1.C_100085
Sequence length 689
Sequence
MNAELRAAGSASALAALVGGVAAHPSPDYVTALRQAGVRTRAVGVATIALTASVLASGLP
LMNVLPRPLLGSLLMANGVELTKLWLWDARRWIDRPGFAMLFAMICSALLFGQTAAVLLG
ALCAVFLSHLRLSRANALKYHLTSRSCHPPASRPHHAQAFLRRHGGAIHLIGLEGFLYGG
TVSRLSRYVLRASERHGREMRFVLLDLQATHGIEPSACTLLRRLRRQLKARGVSLLVAAA
SSQMQGCESRASCGGAPATAALDSAVYRTVDEALESCEEQLLLLGSPVKSSHREGPSAFS
TGGGGRHSGAASVGKGAAEGKGAYGAKVTLQPGELLTSQGNLNREVLVVPPSGAELSVTT
DYGSPDGPLTLATMRHGGVFGAEGVLLGLPSVSSAVLSRSSPPRVVISLSAAQLRGLRLS
QPQLAQQLLAAAFTQQQDYLWLLARRTSLWTGGGHGGPNLDWGSAQPQLVPSADGAPLPT
IPSEVSLPESFGRKEVRSAVLSPWRHAVSPQERTPYSAGSRGAGHIAGLMDELAKAAARR
DSGGVGRRSEQDAALTPLLEKLPARFQQRLLSLVGEKEGAERRVQELERSVHHAEATLKA
ALDSRSVVQANLRASERRIQEAEAAADRHLAAVESEKQRYAILARLADDQAAESKAKISA
QGEQLHVLNEQLGAANRAVGTLRAHQSRR
Download sequence
Identical sequences R1E0I3
jgi|Emihu1|448706|estExtDG_Genemark1.C_100085 XP_005793592.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]