SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|453061|estExtDG_Genemark1.C_730183 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|453061|estExtDG_Genemark1.C_730183
Domain Number 1 Region: 491-582
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000051
Family Anti-sigma factor antagonist SpoIIaa 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|453061|estExtDG_Genemark1.C_730183
Sequence length 712
Sequence
MAFLLDIAPIFGWLRDYPVRSALAHDISGGVTLGCILIGQSLAHAKLCGVELIIGPYSCM
LGPVLYAVFGTCIHSSIGTGALICLLVGEVLVEHGDSVEERSRIAPFLTILVGVILTLMG
VCRLSGLVRFLSRPALSGFITASALLAMLSQVSPMLGLPDSAGSIQKVLLHQPERLLAVK
WPTLLLSAVATGYLLSAKRLKQHPRLKPLGDFKELVLLGLGAAFCAAWDPPGLSQAECVE
HPLCVKVVGRIEPGLPHAHWPRVGAGDWGLIHSMLPGACLVALVAFLTSFAGAKKFGLED
GYQIKPFNELIAIGMCNVGGALLGAVPTSIGNTRMGIARQCGVQSQLGANVFVSIFIALA
VQFFTPCLFYIPMCALNAIILIGSSHMLEFAHAGYLLEFARHKEFGRDGRMDVLVWIVGF
VSTLFLGAFKGIISAVVLSLLIIVVNPHIALLGRQQEPPQSGVPHQPPRFRHRWVNMRGQ
RASGGLVATAVEEEPGVLVFRFEGPLFYANVDQLQEWLEAEELRRIEESPVDYEFKAIIF
SAIAVPFLDTTAIGALQTMIRSYADRNVLFLIANTFANTRRIVAETLGADQRRALREDLR
PRLASCTTVDDFVELVHANRALSKERPRPLIRTTSSLLSLASLASLNATPPKGTLADRQW
PLQRRPFSLACDRTPDAEMGRFTASTPALLSLARPITPRDRAAAGRARPFDR
Download sequence
Identical sequences R1DCS4
XP_005761070.1.92643 jgi|Emihu1|453061|estExtDG_Genemark1.C_730183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]