SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|469173|estExtDG_fgeneshEH_pg.C_2550016 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|469173|estExtDG_fgeneshEH_pg.C_2550016
Domain Number 1 Region: 661-1295
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 4.97e-146
Family Molybdenum cofactor-binding domain 0.000000000311
Further Details:      
 
Domain Number 2 Region: 530-656
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 4.71e-35
Family CO dehydrogenase molybdoprotein N-domain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 117-183
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.66e-29
Family CO dehydrogenase ISP C-domain like 0.00012
Further Details:      
 
Domain Number 4 Region: 270-356
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.69e-27
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00043
Further Details:      
 
Domain Number 5 Region: 361-471
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 8.11e-25
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00018
Further Details:      
 
Domain Number 6 Region: 25-108
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.24e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|469173|estExtDG_fgeneshEH_pg.C_2550016
Sequence length 1316
Sequence
MTRATLAYEETPLSAAALKQYRGSVLLYCNGKRHEIAAADAQMTLLEWLRSEGYTGTKLG
CGEGGCGACTVVLSSRGDGSEVRHSAVNACLMPVCAADWCMVTTVEGIGSSRRGEVHPIQ
ERLAALHGSQCGFCTPGIVMALYAALRTSPDMRAEELTEKLDGNLCRCTGYRPILDAAAS
LCIRDDGGSGCCGGGGGENGGGGNGCGSGNKGCGGGGGAGGCAASLPSDCKLLPDGDVVS
STASKLAKHTTPYAVPLPLARAAAGGCEGEAARACATMLRWFASTQIRNVASLGGNIATA
SPISDMIPTLLACGASLTAASEARGERTVPLAGFVTGYRRVALEPDEVIVSFFVPHCAPL
EFVRPYKQARRREDDISIVSCALRVRLEPAQREGRGVWVVSDAALAYGGLAPTAVLAAKT
ADKLRGCTWDAAAVDALLPAVMSELAVPHDAPGGQPEYRTALAGSFLFKFFEPKPASGGE
QRFPHASYPGLESQSPGGKTAWGIEGPRAIEPPTASEKEARRGGDGGADSDRVRVVGESH
PHAAGRLHTTGEAEYTDDVRPPAGMLHAWLVRATVAPASILRIDAAAARAMPGVADVIFA
SDLPPGGQNALGPVAKDEECFADGHASHVGQVIGVAVADSIEAARAAAEAVAVEYGDPWE
PPIYTIDAAVAAGSFFDGTRGDERTSWSRTGAALGITTAHDLEAGRDIDEAFAEEGLTVV
SGEFRVGGQEHFYLEPMTCLAEPTDDGGISVLSSTQGVDKTHKTVARLLNLPAAKETRTA
FLGAVCAAAAYKVNAPVRLALRRDVDMGTTGGRHPFVVKYTAAARRDGEGVPKLAALKAQ
LYSNGGAFLDLSGPVMDRALLHLDNCYRWPAFSARGVVCRTHTPPNTAFRGFGGPQGLIA
CEHILEHLATELRVPPDALREANMYAEGDALPFGQVLCAGEWRVPRAWRELREGAEVEAR
REAAAAFNAAHRWRKRGVAMLPTKFGINFTAKFMNQGGALVHVYTDGTVLITHGGTEMGQ
GLHTKVCQVAAKAFGVPLSACHVAESASDKVANSIPTAASASTDLYGMATLDACRKILKR
LEPVRNKLGPGASLAELALTAWLDRIDLSAHGFFSISDERCGFDWAIQPGKHADGTPDQT
TRGHPFNYFTQGCAVAEVEVDVLTGDHAVLRADVLLDLGSSINPALDVGQIEGAFVQGAG
WTTTEELIWGDEQHPWVRPQGKLLNSGPGGYKLPAFNDAPRTFNVRLLSGADNPVAVRNA
VRAARASHFPDAADAHLEMYSPATSERIRLACADKIAAAAIGGEAGPAGFQPKGSF
Download sequence
Identical sequences R1EFE6
XP_005777849.1.92643 jgi|Emihu1|469173|estExtDG_fgeneshEH_pg.C_2550016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]