SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|77636|e_gw1.1032.1.1 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|77636|e_gw1.1032.1.1
Domain Number 1 Region: 72-171
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.18e-20
Family 2Fe-2S ferredoxin-related 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|77636|e_gw1.1032.1.1
Sequence length 187
Sequence
MRAAAAASSRLPPPACAARLPLRRGSRPGLASAARRGFLASPVARHGDFEWQDAKSPDEA
RTLPSAKLLGTFLQVRRDVAGKVGDNLLYLCHRLRMSGQVPEITLEGACEASLACSTCHV
IVGDGHFDRLPEPSEDEEDMLDEAVCLTASSRLGCQIVLSKELEGMEITLPAYSKNFYVD
GHVPEPH
Download sequence
Identical sequences R1D133
jgi|Emihu1|69125|e_gw1.94.12.1 jgi|Emihu1|77636|e_gw1.1032.1.1 XP_005756930.1.92643 XP_005793062.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]