SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|42941|estExt_fgenesh1_pg.C_chr_10657 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phatr2|42941|estExt_fgenesh1_pg.C_chr_10657
Domain Number - Region: 77-158
Classification Level Classification E-value
Superfamily SPOC domain-like 0.00334
Family Ku80 subunit middle domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|42941|estExt_fgenesh1_pg.C_chr_10657
Sequence length 461
Sequence
MSPSYPALHLHIDCGHGATGSGVFEAVLGATTEVFKASEFGWVSTLEGFLPQIFPCLKSC
GFELEFTRERYRVATQIHTDEDLSVSMAELIDMLRRSKNNPSIISDRVLDIVIHVLQELA
TAPQDSNNTPTSARKNLTNSVQKYFAPPTEVFASLKSLVSAIQTLAVIWCIFELWGLGDS
IIIRSFTCSPIPWTASTKVDWEEIFHKRQLQPELILGMPIVEDFGAFGNNDRLGIILLRT
LSRQLASYTTIVGKFPPMLLRATATSAGGTGTDINQPTSASVGELLADLNEDTVHSRTRN
EPTLWKADRDMVVLETNIDDLTPERLAFCTEQLLGQGAADAWTTPIVMKKGRAAQTLHCL
CRESEQDILLRCIFRNSTTLGVRIQRLNRVALRREIVIVQTEWRGTASSGLVDVKVGLLE
DEIVSVKAEFDHCKSIALEAGVSIETVSLQAVQLARNKVNM
Download sequence
Identical sequences B7FQ35
2850.JGI42941 XP_002177325.1.39622 jgi|Phatr2|42941|estExt_fgenesh1_pg.C_chr_10657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]