SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|45914|estExt_fgenesh1_pg.C_chr_80266 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phatr2|45914|estExt_fgenesh1_pg.C_chr_80266
Domain Number 1 Region: 361-656
Classification Level Classification E-value
Superfamily SPOC domain-like 7.06e-33
Family Ku70 subunit middle domain 0.00058
Further Details:      
 
Domain Number 2 Region: 701-738
Classification Level Classification E-value
Superfamily SAP domain 0.0000458
Family SAP domain 0.0062
Further Details:      
 
Domain Number 3 Region: 47-118,217-305
Classification Level Classification E-value
Superfamily vWA-like 0.0000477
Family Ku70 subunit N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|45914|estExt_fgenesh1_pg.C_chr_80266
Sequence length 746
Sequence
MDNDSDDDNLWGDEPDWFGDNDDDKNSNKQHGEASTVLPDVPVAQHLLILLDCGPDMLRA
SLPDPEFPDDLIAPLDVVLHACEALVRAQVRASVFAATGQRDALGLYCYNTRPRLPVPTT
TATTKTTTTSFPREDYNDDEEEHEDDNDDDYDRFVHGPLPSTAHEIVPLAPPGKAAVQTL
QAVQDHPVRGRRIDLPQLYGHRHVTSPTTTPTTPTTTAPHPLQTALFHALQVFGRAKCVR
KTTPTRPADWQHVWIFTNNAHPVSSDGDDPDGCSQRQLLQTALHDAAEAGIDVTVWPLPN
GPDQDNVDSSVYEQLEMDVAPSTAWTLLVDILPETHRQWKQARRAVGVPLLLPDWKERPP
NDPNIQLNLYRLVQESRPPKQYHVHQETGRALEKLTQTVTVRGSELLEQSWGTGHAKNSW
GGGADRIQTYVEFGGEKIPMSYADRDAIRRSCNANPDFASLILLGFHDDQSIPLAHTMER
SYFCVPDEESVEGSTAAFAHLHASMLRKKVVAVGELLTKVTAAARLVALVPLPEERVDSH
FDDELPEILRPAGMLVVSLPFEDEVRELDDDEATNVWEATGTDVASPDLVKAATKLIQRQ
IIDSIRIGENFENAALLKMWNYIEHVALEEPMPEQPASETILDKDLVLERARHEIDVFLA
NLPDDSIVEKMPRKRKVEPDDSRLDWFTIWSRDQYFECTNSDLKKKLRSCGEKVSGKKQD
LIDRLVPILENEFGKRVIKSEPLLTE
Download sequence
Identical sequences B7FZ51
jgi|Phatr2|45914|estExt_fgenesh1_pg.C_chr_80266 XP_002180288.1.39622 2850.JGI45914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]