SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|47127|estExt_fgenesh1_pg.C_chr_120225 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phatr2|47127|estExt_fgenesh1_pg.C_chr_120225
Domain Number 1 Region: 300-500
Classification Level Classification E-value
Superfamily SPOC domain-like 3.14e-26
Family Ku80 subunit middle domain 0.0023
Further Details:      
 
Domain Number 2 Region: 17-182
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000477
Family Ku80 subunit N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|47127|estExt_fgenesh1_pg.C_chr_120225
Sequence length 517
Sequence
MNRPYPRATNTRDTASNTTTTRLDCAKQIVTTMVSDLMLQSSANEVCVIVLKTRETSHHK
LAAAGCDLDEEQMDASVPFPNLTDLTNHGVTKPSADLLRKIQNVQSVSEQEASALRGDVC
DGLILAADALYERTHGKKYQRQIVILTDAEHDIVVENSQTLLVVDALRAMDCRLQVVGFD
FLLSASYEQPMEASSLSLNTNAPKPAKTEPDTVSTKRLKKSTDYDSSETEDEDGFATCTQ
KTELDRNDPGQILYSTKEDREQLLSSLAEKTGGDVMAVSTLRQILQVDKGRSLKKATKRK
IELRIAPGIVLPVRSLKMLSKETTLGMKKTAVIGTNKSDTYSTAGNDKAEMDDVRNVYMF
VDPDHKDDVVEPQETIKAVRYGSDLIPMSSYDYEGLKSSANYIPYLEILGYTSRAAIPLV
ALIGPPYALSGSDSRKACAAISALAKSLEQLDRVAICTYMKTKGGDPILGGLFPLSEPQF
KHAARLMFLQLPFAGDMKQLGVVRSEVRFGAPGTKPK
Download sequence
Identical sequences B7G2K3
2850.JGI47127 jgi|Phatr2|47127|estExt_fgenesh1_pg.C_chr_120225 XP_002181221.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]