SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|44688|estExt_fgenesh1_pg.C_chr_40525 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phatr2|44688|estExt_fgenesh1_pg.C_chr_40525
Domain Number 1 Region: 55-205
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000289
Family GAF domain 0.047
Further Details:      
 
Domain Number 2 Region: 318-422
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000301
Family Histidine kinase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|44688|estExt_fgenesh1_pg.C_chr_40525
Sequence length 539
Sequence
MAPPIPTTTTRGRRESAPDWVLTNYDVDTSVPPDVETELRRLRVLQSYDILDREWDTAYD
RLAQIAARALQTPTALVGVVDLGRYWRVALHNCNSNIHHSNNHHHRDAPRELPRKQAIAS
HVILQRQGYLVVMNVGKDSRFVDHPAVRNGTFQFYAGVVLRSPEGYPLGVLAVTDTQPRL
HGVSHEQLQTLRDLADALVDLMHTRRRPKGDTGPAAITRPTAPASTTTTTPPSNPPSPTN
HTNTKDTNNSSSWGVQRSARFLRQYLAKLNDDSTLENVLTKDQRELLRSSYDAAAFLHGS
LLPPEQRQELVRENRPDQVTSVQIASLVQSVELAMDAFPKTVPVRYQIDDEQIPPFVLLV
ELKIFRSCIALLTSACERTRQGVVCLRVFVQQRTVTQKELVFECEDTGPDVELEQYDDLF
DAPLDHTADVGEEDCIRADPHTGKIRKALRCATVPNSRRGHGVHALADFIGSIEGGDYGF
RPRETEDFEPHGTGTGSVFWFSIALHTPPATRHGTDAVVPRRPQPWIISSARGHGSLAK
Download sequence
Identical sequences B7FUX9
jgi|Phatr2|44688|estExt_fgenesh1_pg.C_chr_40525 XP_002178398.1.39622 2850.JGI44688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]