SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|405750743|ref|YP_006674209.1| from Listeria monocytogenes ATCC 19117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|405750743|ref|YP_006674209.1|
Domain Number 1 Region: 203-341
Classification Level Classification E-value
Superfamily CBS-domain pair 8.34e-24
Family CBS-domain pair 0.0026
Further Details:      
 
Domain Number 2 Region: 350-426
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000436
Family CorC/HlyC domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|405750743|ref|YP_006674209.1|
Sequence length 436
Comment hypothetical protein LMOATCC19117_2408 [Listeria monocytogenes ATCC 19117]
Sequence
MDIFNDFFVIFLIAATAFFVASEFAIVAIRKPTVLQLVASEDPRAKYVKKVTSNMNDYLA
ACQLGNTLAALAMGWVGEATMRGWLEPLFLMLPVPESVEKPISIFVSFILITFLNVVLGE
LAPKTFTIQSTEKVALFIARPLVYWYRLTFPLNWLLNNSANLITRMFGVKQTVDADQMTP
TELKIIFEDSYRQGLLNPQEFRYMKNIFKLGDVPAKEVMIPRMSMIAIDQTATVRDLLKL
TSEHTYHIFPVTEDEDKDHIIGMLRVSAVMAGLGKDETIVTQSIQPFITPVLEVFEGMIL
EELLVKMQQESEPFVVLTDEYGGTSGIVTLEDVMEVIVGDMEEAKGPKGIRKVALNHYII
EGSEPLLEVEEALGVPIEGPGVHTLSGWMLLERFDLEAGDEIEHEGYRFIVRSMNKNSIR
QVEVKLGKEKPVKLEE
Download sequence
Identical sequences A0A0B8QS57 A0A241SSN4
gi|405756513|ref|YP_006679977.1| gi|404287770|ref|YP_006694356.1| gi|226224950|ref|YP_002759057.1| gi|525722550|ref|YP_008287160.1| WP_003725593.1.100078 WP_003725593.1.100142 WP_003725593.1.100261 WP_003725593.1.10039 WP_003725593.1.100522 WP_003725593.1.101057 WP_003725593.1.101093 WP_003725593.1.101318 WP_003725593.1.101529 WP_003725593.1.101688 WP_003725593.1.10176 WP_003725593.1.101811 WP_003725593.1.10210 WP_003725593.1.102145 WP_003725593.1.102150 WP_003725593.1.10418 WP_003725593.1.10444 WP_003725593.1.10460 WP_003725593.1.1146 WP_003725593.1.11689 WP_003725593.1.11788 WP_003725593.1.12020 WP_003725593.1.12028 WP_003725593.1.12142 WP_003725593.1.12148 WP_003725593.1.12278 WP_003725593.1.12287 WP_003725593.1.12544 WP_003725593.1.12993 WP_003725593.1.13004 WP_003725593.1.13180 WP_003725593.1.13360 WP_003725593.1.13684 WP_003725593.1.13847 WP_003725593.1.13855 WP_003725593.1.13921 WP_003725593.1.14072 WP_003725593.1.14636 WP_003725593.1.14641 WP_003725593.1.14832 WP_003725593.1.14875 WP_003725593.1.14895 WP_003725593.1.15122 WP_003725593.1.15342 WP_003725593.1.15495 WP_003725593.1.155 WP_003725593.1.15518 WP_003725593.1.15564 WP_003725593.1.15619 WP_003725593.1.15659 WP_003725593.1.1575 WP_003725593.1.15847 WP_003725593.1.16516 WP_003725593.1.16631 WP_003725593.1.1667 WP_003725593.1.16726 WP_003725593.1.16746 WP_003725593.1.1678 WP_003725593.1.1688 WP_003725593.1.17106 WP_003725593.1.17131 WP_003725593.1.17399 WP_003725593.1.17774 WP_003725593.1.18026 WP_003725593.1.18046 WP_003725593.1.18289 WP_003725593.1.18463 WP_003725593.1.18677 WP_003725593.1.18721 WP_003725593.1.18833 WP_003725593.1.19167 WP_003725593.1.19195 WP_003725593.1.19246 WP_003725593.1.1929 WP_003725593.1.19372 WP_003725593.1.19452 WP_003725593.1.19472 WP_003725593.1.19542 WP_003725593.1.19549 WP_003725593.1.19584 WP_003725593.1.19615 WP_003725593.1.197 WP_003725593.1.19901 WP_003725593.1.20263 WP_003725593.1.20378 WP_003725593.1.20548 WP_003725593.1.20672 WP_003725593.1.21338 WP_003725593.1.21371 WP_003725593.1.21428 WP_003725593.1.21429 WP_003725593.1.21529 WP_003725593.1.21567 WP_003725593.1.21706 WP_003725593.1.21711 WP_003725593.1.21874 WP_003725593.1.21889 WP_003725593.1.22099 WP_003725593.1.22188 WP_003725593.1.22194 WP_003725593.1.22221 WP_003725593.1.22597 WP_003725593.1.22776 WP_003725593.1.23139 WP_003725593.1.23255 WP_003725593.1.23291 WP_003725593.1.233 WP_003725593.1.23433 WP_003725593.1.23448 WP_003725593.1.23781 WP_003725593.1.23828 WP_003725593.1.23848 WP_003725593.1.24048 WP_003725593.1.24335 WP_003725593.1.24411 WP_003725593.1.24531 WP_003725593.1.24667 WP_003725593.1.24847 WP_003725593.1.24867 WP_003725593.1.24934 WP_003725593.1.25300 WP_003725593.1.2545 WP_003725593.1.25456 WP_003725593.1.25471 WP_003725593.1.25500 WP_003725593.1.25616 WP_003725593.1.25805 WP_003725593.1.25830 WP_003725593.1.25896 WP_003725593.1.26634 WP_003725593.1.27056 WP_003725593.1.27132 WP_003725593.1.27143 WP_003725593.1.27517 WP_003725593.1.27669 WP_003725593.1.27681 WP_003725593.1.27728 WP_003725593.1.27948 WP_003725593.1.28098 WP_003725593.1.2824 WP_003725593.1.28260 WP_003725593.1.28369 WP_003725593.1.2855 WP_003725593.1.28804 WP_003725593.1.28818 WP_003725593.1.29309 WP_003725593.1.29558 WP_003725593.1.29562 WP_003725593.1.29565 WP_003725593.1.29569 WP_003725593.1.29634 WP_003725593.1.29803 WP_003725593.1.30124 WP_003725593.1.30273 WP_003725593.1.30372 WP_003725593.1.30430 WP_003725593.1.30660 WP_003725593.1.30837 WP_003725593.1.30851 WP_003725593.1.3103 WP_003725593.1.31062 WP_003725593.1.31289 WP_003725593.1.31329 WP_003725593.1.31691 WP_003725593.1.31966 WP_003725593.1.3206 WP_003725593.1.32140 WP_003725593.1.32240 WP_003725593.1.32597 WP_003725593.1.32648 WP_003725593.1.32698 WP_003725593.1.32817 WP_003725593.1.33016 WP_003725593.1.3314 WP_003725593.1.33591 WP_003725593.1.34369 WP_003725593.1.34698 WP_003725593.1.34790 WP_003725593.1.34911 WP_003725593.1.35350 WP_003725593.1.35452 WP_003725593.1.35514 WP_003725593.1.35738 WP_003725593.1.35979 WP_003725593.1.36108 WP_003725593.1.36115 WP_003725593.1.36749 WP_003725593.1.37023 WP_003725593.1.37426 WP_003725593.1.37466 WP_003725593.1.37471 WP_003725593.1.37665 WP_003725593.1.37723 WP_003725593.1.37900 WP_003725593.1.37927 WP_003725593.1.37951 WP_003725593.1.37986 WP_003725593.1.38015 WP_003725593.1.38302 WP_003725593.1.38382 WP_003725593.1.38396 WP_003725593.1.384 WP_003725593.1.38424 WP_003725593.1.38575 WP_003725593.1.39000 WP_003725593.1.39218 WP_003725593.1.39307 WP_003725593.1.39316 WP_003725593.1.39427 WP_003725593.1.39496 WP_003725593.1.39794 WP_003725593.1.39871 WP_003725593.1.39895 WP_003725593.1.40245 WP_003725593.1.404 WP_003725593.1.40556 WP_003725593.1.40580 WP_003725593.1.40841 WP_003725593.1.40978 WP_003725593.1.41023 WP_003725593.1.41222 WP_003725593.1.4166 WP_003725593.1.41700 WP_003725593.1.41876 WP_003725593.1.41970 WP_003725593.1.42040 WP_003725593.1.42310 WP_003725593.1.42339 WP_003725593.1.42525 WP_003725593.1.42550 WP_003725593.1.42564 WP_003725593.1.42926 WP_003725593.1.42994 WP_003725593.1.43060 WP_003725593.1.43304 WP_003725593.1.43336 WP_003725593.1.43458 WP_003725593.1.43480 WP_003725593.1.43768 WP_003725593.1.43916 WP_003725593.1.44092 WP_003725593.1.44230 WP_003725593.1.44427 WP_003725593.1.44596 WP_003725593.1.44663 WP_003725593.1.44703 WP_003725593.1.4472 WP_003725593.1.44749 WP_003725593.1.4503 WP_003725593.1.45355 WP_003725593.1.45512 WP_003725593.1.45541 WP_003725593.1.4562 WP_003725593.1.45719 WP_003725593.1.45778 WP_003725593.1.4578 WP_003725593.1.4587 WP_003725593.1.45893 WP_003725593.1.46180 WP_003725593.1.46277 WP_003725593.1.46425 WP_003725593.1.46456 WP_003725593.1.46566 WP_003725593.1.46711 WP_003725593.1.46867 WP_003725593.1.46981 WP_003725593.1.47001 WP_003725593.1.47075 WP_003725593.1.47384 WP_003725593.1.47431 WP_003725593.1.47518 WP_003725593.1.47520 WP_003725593.1.4753 WP_003725593.1.47650 WP_003725593.1.47759 WP_003725593.1.47952 WP_003725593.1.48007 WP_003725593.1.48161 WP_003725593.1.48175 WP_003725593.1.48410 WP_003725593.1.48440 WP_003725593.1.48441 WP_003725593.1.48565 WP_003725593.1.48854 WP_003725593.1.49 WP_003725593.1.49391 WP_003725593.1.49458 WP_003725593.1.49507 WP_003725593.1.49708 WP_003725593.1.4974 WP_003725593.1.49754 WP_003725593.1.50044 WP_003725593.1.50063 WP_003725593.1.50073 WP_003725593.1.50293 WP_003725593.1.50662 WP_003725593.1.50765 WP_003725593.1.50775 WP_003725593.1.51086 WP_003725593.1.51262 WP_003725593.1.51384 WP_003725593.1.51493 WP_003725593.1.5170 WP_003725593.1.51768 WP_003725593.1.52142 WP_003725593.1.52371 WP_003725593.1.52420 WP_003725593.1.52507 WP_003725593.1.52829 WP_003725593.1.53051 WP_003725593.1.53193 WP_003725593.1.53426 WP_003725593.1.53536 WP_003725593.1.53603 WP_003725593.1.53877 WP_003725593.1.54281 WP_003725593.1.54434 WP_003725593.1.54505 WP_003725593.1.54506 WP_003725593.1.54508 WP_003725593.1.54740 WP_003725593.1.54750 WP_003725593.1.54884 WP_003725593.1.55027 WP_003725593.1.5514 WP_003725593.1.55423 WP_003725593.1.55494 WP_003725593.1.55510 WP_003725593.1.55609 WP_003725593.1.55850 WP_003725593.1.56322 WP_003725593.1.56344 WP_003725593.1.56566 WP_003725593.1.5671 WP_003725593.1.56748 WP_003725593.1.5687 WP_003725593.1.57106 WP_003725593.1.57228 WP_003725593.1.57374 WP_003725593.1.57932 WP_003725593.1.58083 WP_003725593.1.58491 WP_003725593.1.58966 WP_003725593.1.59113 WP_003725593.1.59353 WP_003725593.1.59493 WP_003725593.1.59652 WP_003725593.1.59695 WP_003725593.1.59720 WP_003725593.1.59826 WP_003725593.1.60132 WP_003725593.1.60162 WP_003725593.1.60543 WP_003725593.1.60674 WP_003725593.1.60762 WP_003725593.1.60766 WP_003725593.1.60768 WP_003725593.1.61072 WP_003725593.1.611 WP_003725593.1.61274 WP_003725593.1.61358 WP_003725593.1.61371 WP_003725593.1.61384 WP_003725593.1.61525 WP_003725593.1.6236 WP_003725593.1.62375 WP_003725593.1.62573 WP_003725593.1.62690 WP_003725593.1.62874 WP_003725593.1.63209 WP_003725593.1.63269 WP_003725593.1.63283 WP_003725593.1.63315 WP_003725593.1.63605 WP_003725593.1.63842 WP_003725593.1.63883 WP_003725593.1.64147 WP_003725593.1.64289 WP_003725593.1.64587 WP_003725593.1.64796 WP_003725593.1.64869 WP_003725593.1.65143 WP_003725593.1.65392 WP_003725593.1.65561 WP_003725593.1.66134 WP_003725593.1.66138 WP_003725593.1.66285 WP_003725593.1.66545 WP_003725593.1.66596 WP_003725593.1.6745 WP_003725593.1.67551 WP_003725593.1.67573 WP_003725593.1.67654 WP_003725593.1.67813 WP_003725593.1.67926 WP_003725593.1.68128 WP_003725593.1.68208 WP_003725593.1.68236 WP_003725593.1.68282 WP_003725593.1.68497 WP_003725593.1.68517 WP_003725593.1.68525 WP_003725593.1.68740 WP_003725593.1.69263 WP_003725593.1.69360 WP_003725593.1.69603 WP_003725593.1.69864 WP_003725593.1.69989 WP_003725593.1.70100 WP_003725593.1.70122 WP_003725593.1.7026 WP_003725593.1.70736 WP_003725593.1.71381 WP_003725593.1.71437 WP_003725593.1.71726 WP_003725593.1.71763 WP_003725593.1.71858 WP_003725593.1.71904 WP_003725593.1.72264 WP_003725593.1.72370 WP_003725593.1.72623 WP_003725593.1.72813 WP_003725593.1.72886 WP_003725593.1.72918 WP_003725593.1.73152 WP_003725593.1.73263 WP_003725593.1.73508 WP_003725593.1.73545 WP_003725593.1.74095 WP_003725593.1.74148 WP_003725593.1.7421 WP_003725593.1.74436 WP_003725593.1.74617 WP_003725593.1.74728 WP_003725593.1.74823 WP_003725593.1.74927 WP_003725593.1.74956 WP_003725593.1.7504 WP_003725593.1.75072 WP_003725593.1.75196 WP_003725593.1.7553 WP_003725593.1.75548 WP_003725593.1.7565 WP_003725593.1.75838 WP_003725593.1.75869 WP_003725593.1.75923 WP_003725593.1.76094 WP_003725593.1.76168 WP_003725593.1.76247 WP_003725593.1.76367 WP_003725593.1.76545 WP_003725593.1.76608 WP_003725593.1.76926 WP_003725593.1.7718 WP_003725593.1.77191 WP_003725593.1.77222 WP_003725593.1.77261 WP_003725593.1.77345 WP_003725593.1.7738 WP_003725593.1.77389 WP_003725593.1.77594 WP_003725593.1.77675 WP_003725593.1.77697 WP_003725593.1.77849 WP_003725593.1.77928 WP_003725593.1.78088 WP_003725593.1.78130 WP_003725593.1.78315 WP_003725593.1.78681 WP_003725593.1.78717 WP_003725593.1.79128 WP_003725593.1.79149 WP_003725593.1.79259 WP_003725593.1.79602 WP_003725593.1.79821 WP_003725593.1.80088 WP_003725593.1.80514 WP_003725593.1.80693 WP_003725593.1.81140 WP_003725593.1.81315 WP_003725593.1.81476 WP_003725593.1.81495 WP_003725593.1.81647 WP_003725593.1.81863 WP_003725593.1.82372 WP_003725593.1.82662 WP_003725593.1.82821 WP_003725593.1.82974 WP_003725593.1.83015 WP_003725593.1.83130 WP_003725593.1.83217 WP_003725593.1.83755 WP_003725593.1.83809 WP_003725593.1.83907 WP_003725593.1.84180 WP_003725593.1.8465 WP_003725593.1.84895 WP_003725593.1.84974 WP_003725593.1.85036 WP_003725593.1.85172 WP_003725593.1.85194 WP_003725593.1.85317 WP_003725593.1.85321 WP_003725593.1.8539 WP_003725593.1.85576 WP_003725593.1.85690 WP_003725593.1.85887 WP_003725593.1.85890 WP_003725593.1.86056 WP_003725593.1.86098 WP_003725593.1.86232 WP_003725593.1.86279 WP_003725593.1.86571 WP_003725593.1.86683 WP_003725593.1.86752 WP_003725593.1.87101 WP_003725593.1.87294 WP_003725593.1.87328 WP_003725593.1.87329 WP_003725593.1.87436 WP_003725593.1.87537 WP_003725593.1.87890 WP_003725593.1.88211 WP_003725593.1.88397 WP_003725593.1.88422 WP_003725593.1.88463 WP_003725593.1.88768 WP_003725593.1.88783 WP_003725593.1.88800 WP_003725593.1.88806 WP_003725593.1.88895 WP_003725593.1.89267 WP_003725593.1.89387 WP_003725593.1.89505 WP_003725593.1.89756 WP_003725593.1.89897 WP_003725593.1.89916 WP_003725593.1.89969 WP_003725593.1.90212 WP_003725593.1.90326 WP_003725593.1.90459 WP_003725593.1.90741 WP_003725593.1.90772 WP_003725593.1.90857 WP_003725593.1.90963 WP_003725593.1.91084 WP_003725593.1.91140 WP_003725593.1.91195 WP_003725593.1.91443 WP_003725593.1.91560 WP_003725593.1.91922 WP_003725593.1.92288 WP_003725593.1.9243 WP_003725593.1.92494 WP_003725593.1.92591 WP_003725593.1.92963 WP_003725593.1.93049 WP_003725593.1.93325 WP_003725593.1.93421 WP_003725593.1.93490 WP_003725593.1.93534 WP_003725593.1.93558 WP_003725593.1.94206 WP_003725593.1.94225 WP_003725593.1.94233 WP_003725593.1.94336 WP_003725593.1.94401 WP_003725593.1.94431 WP_003725593.1.94447 WP_003725593.1.94499 WP_003725593.1.94537 WP_003725593.1.94554 WP_003725593.1.94613 WP_003725593.1.9470 WP_003725593.1.94795 WP_003725593.1.94906 WP_003725593.1.9502 WP_003725593.1.9505 WP_003725593.1.95100 WP_003725593.1.95146 WP_003725593.1.9517 WP_003725593.1.95197 WP_003725593.1.96084 WP_003725593.1.96156 WP_003725593.1.96422 WP_003725593.1.96438 WP_003725593.1.96449 WP_003725593.1.96496 WP_003725593.1.96596 WP_003725593.1.96605 WP_003725593.1.96708 WP_003725593.1.96751 WP_003725593.1.96835 WP_003725593.1.96867 WP_003725593.1.97378 WP_003725593.1.97469 WP_003725593.1.97569 WP_003725593.1.97589 WP_003725593.1.9768 WP_003725593.1.97803 WP_003725593.1.97900 WP_003725593.1.97970 WP_003725593.1.9802 WP_003725593.1.98490 WP_003725593.1.98689 WP_003725593.1.98826 WP_003725593.1.98974 WP_003725593.1.99518 WP_003725593.1.99553 WP_003725593.1.99568 WP_003725593.1.99702 WP_003725593.1.99818 WP_003725593.1.99836 WP_003725593.1.99906 gi|406705135|ref|YP_006755489.1| gi|405750743|ref|YP_006674209.1| gi|386733085|ref|YP_006206581.1| gi|46908573|ref|YP_014962.1| gi|405753608|ref|YP_006677073.1| gi|404281957|ref|YP_006682855.1| 265669.LMOf2365_2373 634178.Lm4b_02371 gi|525734685|ref|YP_008290633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]