SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thaps3|1751|fgenesh1_pg.C_chr_1000885 from Thalassiosira pseudonana CCMP1335

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thaps3|1751|fgenesh1_pg.C_chr_1000885
Domain Number 1 Region: 9-194
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000309
Family Fibronectin type III 0.006
Further Details:      
 
Domain Number 2 Region: 305-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000027
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Thaps3|1751|fgenesh1_pg.C_chr_1000885
Sequence length 588
Sequence
MPQKQRLPPAPNLTISNVGTSSADVTWVGRHHSENDTPLFFCLEMRESLSKEDFVLVFTD
PPSPDLEPKMRIKLNDLASNTTYILRIKSINENGAGRFTTETFTTTPTQPLAPRLLSATT
SSLQIRLCTSNHDAKHKSMTSSPKYNIDIRNVDAPNSEWITVAKNRLSDVQIHGLTDGSS
HILRCRAVNANGIEGVCRESTPMFHTLLSYNGRPSVQEVGSDFARLSFGTSAIAHKRNIE
EYHQWIQHESKEIHKVFKEVLIKGNPSMEINENHEPTMPVHLLPQLLTCLGTKPSSIRLE
TLSQDQTDGSISLSAVTRWWNDTSPLAYTIRRSDSNESLVCYNSSRRDDDDAMIQGLHPN
TKYSFSVRYTTSRTTSLWCDDITCTTLPRTPPFRPALVRITHQMCLLKINGFDAKERYRV
EHLSVSDKRPQWRTVFNGAMPKCLVKLNNFNGGEIHKFRIRGLNSEGSPGKCSGALTITI
AGERGPDTSIDILKEFTIDCTADDIIVGDRVLLDEYVEGNTLRTIAVQINAIFTRNETQS
YRMEVLWCHCSRLNSKAMLKVGQLVERPMDDFAERVLRTKWASEDDRR
Download sequence
Identical sequences B8BRU5
35128.JGI1751 jgi|Thaps3|1751|fgenesh1_pg.C_chr_1000885 XP_002286963.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]