SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Thaps3|268582|estExt_thaps1_ua_kg.C_chr_30366 from Thalassiosira pseudonana CCMP1335

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thaps3|268582|estExt_thaps1_ua_kg.C_chr_30366
Domain Number 1 Region: 30-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-55
Family Tandem AAA-ATPase domain 0.0000843
Further Details:      
 
Domain Number 2 Region: 398-508
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000748
Family C-terminal fragment of elongation factor SelB 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Thaps3|268582|estExt_thaps1_ua_kg.C_chr_30366
Sequence length 518
Sequence
MKGRDVFVLMPTGGGKSLCYQLPAWCCPGLSVIISPLLSLIEDQVQSMTKLGVRSVFLNS
AQSWEDEQRNIVDELRRTPIHGGIKLLYITPEKLAHSNMIKGVLSNLANNGRISRFVVDE
AHCLSDWGHDFRPDYNQLGCLRRDYPNVPLMALTATANKKVVSDAIRALGMRNEYSYRSS
FNRPNLHYEVRRKDNKTVDTIADYIAERRNDSGVIYCLSRKDCETLSDKLNNKLREKGFR
DVRVSYYHAELDQRERHQRHHAWSLGHISVLCATIAFGMGIDKPDVRYVMHYSMPKSITH
YYQESGRAGRDGGNADCILFYAYKDKKTLEMMIRKAAGHNQRSQATLRKIDHLYTCLRYC
ENTFECRRTLQLQFFGEMFEKHKCNKTCDNCRLGLVEEKRDMTNSAREILQLLDSRGRGV
TLHQLAELWRGTKSKAHTKFLITENLNGYGKGKAVSKSETDALVHAMVFEGVIEELSEET
TGGFAADYVHPGKNAALVQSGRQQFFVSFPKDPPKAAA
Download sequence
Identical sequences B8BWN4
jgi|Thaps3|268582|estExt_thaps1_ua_kg.C_chr_30366 35128.JGI268582 XP_002288630.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]