SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75674620|ref|YP_317041.1| from Nitrobacter winogradskyi Nb-255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75674620|ref|YP_317041.1|
Domain Number 1 Region: 153-574
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.07e-92
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0065
Further Details:      
 
Domain Number 2 Region: 615-832
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.55e-52
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75674620|ref|YP_317041.1|
Sequence length 985
Comment 2-oxoglutarate dehydrogenase E1 component [Nitrobacter winogradskyi Nb-255]
Sequence
MSRQDANAAFALSSFLQGANAGYIDELYARYEKDPGSVDAAWQEFFKSLKDSPQDVEKNA
RGPSWERANWPQAPRDDLTSALDGNWARFEKTADVKAQETAKPKASVLAGGDVNQATRDS
VRALMLIRAYRMRGHFHARLDPLGLEPARDREELDPRAYGFTEADMDRKIFLDHVLGLEY
GSLREIVAICQRTYCQTLGVEFMHISDAAQKSWIQERIEGPDKEISFTPEGRRAILIKLI
EAEGFEKFCDVKFTGTKRFGLDGGESLIPALEQIIKRGGNLGVKEIVIGMPHRGRLNVLT
QVMGKPHRALFHEFKGGSVNPDSVEGSGDVKYHLGASSDREFDNNRIHLSLTANPSHLEI
VDPVVLGKVRAKQDQHGDPPEQRNSVLPLLMHGDAAFAGQGVVAECFALSDLKGYRTGGS
IHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHVNGDDPEAVVFAAKVAVEFRQKF
HKPVVIDMFCYRRHGHNEGDEPSFTNPLMYKKIAVHPSTLELYAKRLSAEGIITEGEIEK
LKADWRARLDAELEAGAGYRPNKADWLDGKWAGLKLADQSEEPRRGVTGVSIETLKKIGR
SITRVPDGFRVHRTVQRFLDNRARAIESGAGIDWATAEALAFCTLMLEGHNVRLSGQDSE
RGTFSQRHSVLFDQEDESRYTPFNHLDADHGCYEVINSLLSEEAVLGFEYGYSLAEPNTL
TMWEAQFGDFANGAQVLFDQFISSGERKWLRMSGLVCMLPHGYEGQGPEHSSARLERFLQ
MCAEDNMQVVNITTPANYYHALRRQLKRQIRKPLIMMTPKSLLRHKRVVSRLDELGADTA
FHRILYDDATMLPEQKIRLVDDDKIRRVVLCSGKVYYDLYEEREQRDINDVYLMRIEQLY
PVPLKALVQVLGSFKNAEIVWCQEEPRNMGAWLFIEPYLEWVLNQIGAPGKRPRYVGRAA
AAATATGLMSKHLAQLKAFLDEALS
Download sequence
Identical sequences Q3SVK2
gi|75674620|ref|YP_317041.1| WP_011313753.1.37845 323098.Nwi_0422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]