SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75675709|ref|YP_318130.1| from Nitrobacter winogradskyi Nb-255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75675709|ref|YP_318130.1|
Domain Number 1 Region: 244-608
Classification Level Classification E-value
Superfamily SIS domain 9.28e-110
Family double-SIS domain 0.0000000861
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.4e-72
Family Class II glutamine amidotransferases 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75675709|ref|YP_318130.1|
Sequence length 608
Comment glucosamine--fructose-6-phosphate aminotransferase [Nitrobacter winogradskyi Nb-255]
Sequence
MCGIVGILGRGPVAEQLVDSLRRLEYRGYDSAGIATLEGACLARRRAEGKLRNLAGRLQA
EPLIGQVGIGHTRWATHGRPTENNAHPHATERVAVVHNGIIENFRELREKLKKNGAVFET
ETDTEAVLHLVDGYLAAGIDPVEAVRATLSQLRGAFALGFIFAADDDILICARNGPPLAI
GYGDGEMYLGSDAIALGPLTDTISYLEDGDWAVLTHDGATVYDHHNAVVQREVVKQSASA
SLVDKANYRHFMAKEIHEQPEVVGHTLARYVDMATERVSLPVDLPFDFREIKRVSIIACG
TANYAGYIGKYWLERLGRLAVEIDIASEFRYREAPLGKGDLAIFISQSGETADTLAALRY
AKQHGLHTLSIVNVTTSTIARESETMLQTLAGPEIGVASTKAFTCQLMVLATLAIAAGKV
RGELSEEDEARLVHDLIEVPRLMSEALATEPQIDRLAREIAKSRDVLYLGRGTSYPLALE
GALKLKEISYIHAEGYAAGELKHGPIALIDENMPVVVIAPYDRVFEKTVSNMQEVAARGG
NIILMTDAKGAAEAAVEPLETIIMPDMAATFAALIYAVPVQLLAYHTAVVMGTDVDQPRN
LAKSVTVE
Download sequence
Identical sequences Q3SSG3
323098.Nwi_1517 gi|75675709|ref|YP_318130.1| WP_011314784.1.37845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]