SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75675937|ref|YP_318358.1| from Nitrobacter winogradskyi Nb-255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75675937|ref|YP_318358.1|
Domain Number 1 Region: 721-957
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.85e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 
Domain Number 2 Region: 438-622
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.1e-18
Family PFOR PP module 0.038
Further Details:      
 
Domain Number 3 Region: 42-224
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.83e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.042
Further Details:      
 
Domain Number 4 Region: 268-356
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000191
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75675937|ref|YP_318358.1|
Sequence length 1165
Comment indolepyruvate ferredoxin oxidoreductase [Nitrobacter winogradskyi Nb-255]
Sequence
MGINQGPISLDQKYTQGSGHVFMTGLQALVRLPMAQIRRDRAAGLNTAGFISGYRGSPLG
GYDQQLFAARHHLDRHGIKFQPGVNEDLAATAVWGSQQVNLSPGARYDGVVGLWYGKGPG
VDRCGDVFRHGNAAGSARNGGVLCLAGDDHGAKSSTVPHQSDHAFIAALMPYLYPSSIHE
MIEMGLLGIAMSRYSGCWVGMKVITETVETTAEIDLTDEMKPFVIPADFEMPPGGLNLRW
PDDRYDQDLRLQDHKGFAAVAFARANNINRVTMDSPNARFGIVASGKSYEDIRQALRELG
ITEQVAAKIGLRLLKIGMPWPLEPQSIREFAVGLEEIFIVEERREIVENQIKRELFNWRD
DVRPRIIGKMDDHDKRFLPFAQELGVASLASYLTERLLRLNLNPEIAEMLRAKADWFNGR
QASQMQPATPVMRVPYFCSGCPHNTSTKVPDGSRAMAGIGCHFMALWMDRNTETYTHMGG
EGAPWVGIAPFTNEKHIFANLGDGTYFHSGSLAIRQAVASGANITYKILYNDAVAMTGGQ
HFDGELSPQRITFQLHAEGIRDIYLVSESPDSYPASDIAPGTRTAHRDDLDAVMKTCRET
KGTSAIVFVQTCAAEKRRRRKRGLMEDPQRRVLINPEVCEGCGDCSVQSNCISVEPLETE
MGRKRSINQSSCNKDYSCLKGFCPSFVTIDGGRLRKRAPADLGEIGDLPEPASRPSLDRP
YNIGVGGVGGTGVLTIGALLGMAAHIEGKASMILDMSGLAQKGGAVLSHVRLSRNPAEVI
CSRIVTGTADLVIAADEVVAAAKETITLCESSRTYGLINTHLIPTAGFVLDRDFNFQSGK
VGRVLETALRKDSTFFNFTRPAETLLGDSIATNMMMMGYAYQKGLLPLTSEAIEQAIEMN
GVAVKMNVGAFRLGRLAVVDPARLVEMMKGTGEAAPPKALGDMSLDEIVVHRAAHLADYQ
NARLADKYRAMVSRIRQAANEGGYGDALPRAVAINYAKLLAYKDEYEVARLYTDGRFRKQ
VSDQFEGDYSIRFHLAPPLFDGRKDALGRPAKKPYGKSLMMPVFRLLAKMKGLRGTAFDV
FGYNPERRLERSLIAEYETDVAAVLDRLSPANVEAAIELLSLPDRIRGYGPVKEKAVADT
RGRHAELLRDLANPPPVAPRQMAAE
Download sequence
Identical sequences Q3SRT5
gi|75675937|ref|YP_318358.1| WP_011315002.1.37845 323098.Nwi_1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]