SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75676138|ref|YP_318559.1| from Nitrobacter winogradskyi Nb-255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75676138|ref|YP_318559.1|
Domain Number 1 Region: 7-366
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.73e-72
Family TK-like PP module 0.08
Further Details:      
 
Domain Number 2 Region: 373-589
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.83e-26
Family TK-like Pyr module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75676138|ref|YP_318559.1|
Sequence length 795
Comment phosphoketolase [Nitrobacter winogradskyi Nb-255]
Sequence
MAELDDTQLGLMNLYWRAANYVSVGQIYLMDNPLLRKPLKAEDVKPRLLGHWGTTPGLNF
IYVHLNRVIRERGTDVLYICGPGHGGPAMVANTYLEGSYSEIYPGITQDEAGLQKLFRQF
SFPGGVPSHVAPETPGSIHEGGELGYALVHAFGAAFDNPDLTVACVVGDGEAETGPLAAA
WHSNRFLNPQVDGAVLPILHLNGYKIANPALLARMSEAELSDLFRGYGYEPLFVEGHEPI
PMHRTMAESLDLAMDRIRDIQREARKEGWSGERPRWPMIILRSPKGWTGPKEVDGKKVED
FWRSHQVPVSNARGDATHRKILEEWLRSYRPQELFDGKGRFLPEIAALAPEGAKRMGALP
HANGGLLKKDLILPDWKSLALDIGQPGETIAEATRLMGAYLREVIRLNAEARNFRLMGPD
ETASNRLDAVFEVTNRVWMEKIESYDVHLACEGRVMEVLSEHLCQGWLEGYLLTGRHGVF
SCYEAFIHIVDSMVNQHAKWLKVSAELPWRKPIASLNYLLTSHVWRQDHNGFSHQDPGFA
DFVANKKADIVRLYFPPDANTLLWVTDHCLRTWNRINVITAGKQPQPQWLTAEQAERHCE
AGAGIWEWACTCPADEEPDVVMACCGDVPTLEILAAVGLLRRELPDLRIRVVNVVDLMTL
QSHTTHPHGFTDDEFDALFTKEKPVIFAYHGYPYLIHRLTYKRTNHANFHVHGFQEEGTT
TTPFDMAVMNELDRFHLVIAAVRRLPNLGMGGERVIGRCEQALAEHASYARQYGEDMPEI
REWSWPYKTAAEAGD
Download sequence
Identical sequences Q3SR84
gi|75676138|ref|YP_318559.1| WP_011315198.1.37845 323098.Nwi_1947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]