SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75676825|ref|YP_319246.1| from Nitrobacter winogradskyi Nb-255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75676825|ref|YP_319246.1|
Domain Number 1 Region: 391-812
Classification Level Classification E-value
Superfamily SIS domain 1.78e-86
Family Phosphoglucose isomerase, PGI 0.00021
Further Details:      
 
Domain Number 2 Region: 16-385
Classification Level Classification E-value
Superfamily Aldolase 9.89e-83
Family Class I aldolase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75676825|ref|YP_319246.1|
Sequence length 965
Comment bifunctional transaldolase/phosoglucose isomerase [Nitrobacter winogradskyi Nb-255]
Sequence
MEFLQTARPRTEKNVMNPVRELQNHGQAIWLDFLARGFITKGDLKTLVDNDGLRGVTSNP
SIFEKAIGSSDEYDSAIVSLMKKGDRSVADLYEQLAIEDIQHAADVLRPAYDRLDGADGF
VSLEVSPYLANDTEGTIAEARRLWKSVNRKNLMIKVPATPNGLPAIQQLISEGISVNITL
LFSQKVYVEVAEAYLAGLQNYIRNGGDPAHVASVASFFVSRIDSAADKQLDEKIAQANDP
AEKARLAALKGKVAIANAKLAYQEYKQLFAGEDWQKLEAEGARPQRLLWASTGTKNKDYR
DVLYIEELIGPDTVNTVPPATLDGFRDHGELRDSLEENLDDARQVLAALADAGISLDAIT
RDLVTEGVKLFEDAADKLLGAVARKREKILGSAIDRQTLSLDPSTAKSVEAKADDWRAAG
AVRKLWQKDKSVWTNTDEDKWLGWLTSPAAELDRAADYEDYAWRVKKQKFTDAVVLGMGG
SSLGPEVLAKTFPKAAGFPKLHVLDSTDPAEIRSLEAAIDIARTVFIVSSKSGGTTEPNA
LKDYFHARVAKAIGADKAGHRFIAITDPGSSLDAEAARLGYARTFHGDPEIGGRYSILSP
FGLVPAATAGIDVTGLLEGALVMVRSCGAQVPPHDNPGVQLGLAMGLAGREGRDKVTILA
SPKIADFGAWAEQLIAESTGKEGKGLIPVDGEPLGDASLYGDDRFFIDIRTADEEDAAHD
EKLRALENAGHPVVRIVMNSIEQIGQEFFRFEIAAAVAGAVLGINPFDQPDVEAAKIRTR
ELTSAFEKTGRLPDEEPAISANGFDIYTDAENARALREKGADGELSSWLKAHLSRAEPGD
YVALLAYVARNEDHIGELQRMRLAVRDRKKVATCAEFGPRFLHSTGQAYKGGPDSGVFLQ
ITADDPRDLKIPGRKMSFSIIKAAQARGDFDVLTRRGRRALRVHLKGNLKSGLSRLDDAI
SRALM
Download sequence
Identical sequences Q3SP97
gi|75676825|ref|YP_319246.1| 323098.Nwi_2641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]