SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA00454 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA00454
Domain Number 1 Region: 163-555,667-701
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-52
Family FAD-linked reductases, N-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 60-152
Classification Level Classification E-value
Superfamily Homeodomain-like 4.84e-19
Family SWIRM domain 0.00069
Further Details:      
 
Domain Number 3 Region: 538-643
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.35e-17
Family L-aminoacid/polyamine oxidase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA00454   Protein: JA13118   Gene: WBGene00119658
Sequence length 982
Comment JA13118 WBGene00119658 locus:Cjp-lsd-1 status:Predicted
Sequence
MPSSSDPDYEDEEEAKTLRRAGRRPVQRESREEPGEILRLTPQYQEPFSVWLGDSSIQDA
AMRVNMPGDRPTEHELAFFPELWESIAGRDVYLFIRNTAIMTWHLNLLNECTTDSVRNRL
KPPFDSDVDLIHKIVAYLTRHGIINFGRFTRQTRLQRYLPAGKRTVAVIGAGAAGIAAAS
QLKSFGFDVIVLEGRERVGGRVQSFRSKGQLIEAGCDMLHNIYRSPLEILIAQMEEVGLV
ASSPTRVYCDGKLAHEARHKLITSYYKQMCEGLHYLAHNSEQRDEVTNHYVSRQRVFENL
FNMIERRQKLNYFNYCSANLEMSLKREEHFQKMGHLRNVAMMAEEKLLETPLDDHLLQRS
LFRDIKITLQHFDEEFDAFQLVENHLLHHKKHPCAQQYMAPGDFRQYNFHLGFEEILQGA
QLEKLQFTQFTSPDKIEQSMTRVPNGIYSVLAKLARDRELDIRCNTKVCEIDTTMDNLVR
VVAVKDDGEKIDFTVNFVVSTIPNGVLKKTVENDPIGPKFEPPLPKNKVEAIKALGKSII
NKIILVFERNFWEDNGGCAFCNIAPTVPHRASMTYWTSLPGSNVLTTYFVGEMSIHKLSD
EILIKTAMDVLKKIFPVWCPDVPQKAFVTRWHTDEFAFGTGSFRSLTTKEHHFDDLIEPL
KTKDGENRVYFAGEATSAQHLNTIQGAWTSGMRAAADLANDHNGPSFVMQKYVTPTSSPV
KPPQVAVPSKKLVVRPASHLQVIPRPAPRQSLPPSRPAFIPTPVRVSLPSSSSSSATATT
ASPQVRLVRPLPPTARRSSSSRVLPDEVACLLPDELSSELTVTYARTLAGACSDRYRSSA
SPSLASQPSTSNQITEQARAQYQQTLQRQEALQRIEKQLSVPVSPLLRTSPQEGSLTDRV
MDGLRQQQEKSAPKNIGKPSPRPSTSGYVSSRPSTSAYASPARQVPPTRFVFQSAATATA
ASTSTPARPSTPSSRPRASSKK
Download sequence
Identical sequences CJA00454 281687.CJA00454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]