SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA00513 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA00513
Domain Number 1 Region: 246-675
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.78e-33
Family Reverse transcriptase 0.0058
Further Details:      
 
Domain Number 2 Region: 969-1144
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.12e-21
Family Retroviral integrase, catalytic domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA00513   Protein: JA32484   Gene: WBGene00119717
Sequence length 1365
Comment JA32484 WBGene00119717 status:Predicted
Sequence
MTIREGEMEVRGINGIETVKSSCVELKIKTTGNEVWITRIVTYPVFPIKFQAPKFSLEDI
KYLKSVNIDVDSITNTKIYNEKPIDMILGNDFLATAAPNMNKKLLPSKRAIDVTPMGIIT
YPTPNNDFLISQESILNIEIKDYFKPIFINALQTKSYQSVSDQDLQERVAQLFELEHVGI
TPPDSNEAKQTKDQYLIQKFKHEAKMLDGKIHVALPYNGKQKELKDNYPIAIKRLTSLAK
NLNKCKETRQEYHKIIQSQLESGNIETVNEQKQPTNVPVYYIPHRNVMKDDSLTTKLRIV
LDASSHMRENISLNDCLHAGPSILQSILGIMLRARLSNYLLVADIEKAFHQVRVQEEYRD
VTRFLWLKNPELGVTPENIVTYRFSRLPFGVSCSPFLLAVTILLYLEINPNEINERIIKN
LYVDNVMITTNEEQELHKIYKSTKQIFEKMGMNLREYQMNSQKTRQSIPEVDRASEETVK
LLGHLWNCNSDTITIKIPKPPEGVPTKREVVSFLASIYDPMGILSPIIVPIKELTQDLWE
EEISWKEKIPNRISQKWETIKATFKQTSYTMPRSLVSVANYNTVQLLLFSDASERHFATA
AYLHFKFENSNPITKLIMAKSKVKPKGTELSIPRLELMAIEIAVNAAKTLTQELELKSLS
NIKFFSDSMIALYWVLKREKLTKFVDNRVSKIHNIAQSLKEQNLKPSFHHCPTDQNPADI
ASRGSTIDKLVGNLLWEEGPEFLKRAENEWPIRLEGTINYPSEFRDLIEKEVTWKKSIKT
KTKKSIVRYKSAKSFEKLITTMSMVFRWYTRKLSNKKWNSRLMTKLAESNTDEISRRTLV
RDFIIADHYQDQERKGIPIPQKLNFIKEESGILRHPRNLKRSELPQESKEPIFIIRDHDL
AYLIVRDIHRRNAHLSANYMMGAVYRKYWIEKVGKIIRKVTQQCYKCKKQSGQPFQYQYS
KNLPECRTIPAAPFRHVGLDYFGPIRYTNVLNKSTKTWVMLVTCLVTRAVHLELVTDNST
ITYLLALKRYFGRRGVPKSILCDNAPGFILGNKMINDDIRNKIHASETLTTFLASREIEL
KYITPLSPWQGGVYERIVGIIKNQFYKTISKEELSYVELETVLIEVEASVNSRPITKDQS
NPNEPFALRPIDFIIPNIHLTIPNNINENTVSESRTEKLTLQYHTALNKVLDKLWEMWST
QYLLNLQESKTKRHNFTKTKPKMGQLVLLHQEKTARHKWPLAQIVKLLPSADGMIRSVLI
KCQKQLLKRSVKHLIPLEIDETEQDEKIREDTDNTQTEQNDTRNPENYELTKESEENLNE
NKIQTKRTGDLENETRKNLPRKAKKPINYAKMNRGFSVAGGSVAE
Download sequence
Identical sequences 281687.CJA00513 CJA00513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]