SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA01744 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA01744
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0536
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA01744   Protein: JA18052   Gene: WBGene00120948
Sequence length 112
Comment JA18052 WBGene00120948 status:Predicted
Sequence
MKRIECFMVPWLTLQLIFLTSFSLFVIVWWIATLLSLFNLVQYFHTNDDKGLTNSEFFVL
TGVILTVVLFISMKVSHVLYKGFVRVRDQNISVYRVTEAIERDRTVLKPSYV
Download sequence
Identical sequences A0A2H2HWR0
CJA01744 281687.CJA01744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]