SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA02190 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA02190
Domain Number 1 Region: 11-428
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.57e-133
Family FMN-linked oxidoreductases 0.00000000113
Further Details:      
 
Domain Number 2 Region: 488-727
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 1.83e-80
Family Alpha subunit of glutamate synthase, C-terminal domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 1010-1367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-51
Family FAD-linked reductases, N-terminal domain 0.047
Further Details:      
 
Domain Number 4 Region: 863-1021
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.78e-36
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA02190   Protein: JA34736   Gene: WBGene00121394
Sequence length 1388
Comment JA34736 WBGene00121394 status:Partially_confirmed
Sequence
MKTQFNSRDSKTLVASGTFHWRAGGEKHINEPLAIAKLQAATRLNNPKTFQEYSQASNMA
QRWCTLRGQLEIKTSPKVQVPLSEVEPAAEIVKRFVTGAMSFGSISWEAHTALAVAMNRI
GAKSNTGEGGEKPERYRKDQDPNLNLRSAIKQVASARFGVTSSYLANADELQIKMAQGAK
PGEGGELPGHKVTQDIADTRKSTAGVGLISPPPHHDIYSIEDLAQKKKSEKTTEMIFQLI
YDLKCANPVARVSVKLVSEAGVGIIAAGVAKGNADHITVSGHDGGTGASSWTGIKHAGLP
WELGVAETHQVLTMNNLRSRVVLQADGQIRTGRDVMIAALLGADEFGMSTAPLIVLGCTM
MRKCHLNTCPVGVATQDPVLRAKFDGKPEHVVNYMFMVAEEVRYFLSKLGLTKLEDAVGR
TDLLYASPNPVNKKATMLEFGSILKNAQQMFPNVSIRGGSVKQVIEMGALETELLKDVEN
VFSESGEHKVFDNQIITNLDRTFGTRISYEISKRYGETGLEGSRSITINLKGHAGQSFCA
FLAKGVRITLEGDANDYVGKCLSGGNIVVFPPKTAQFKSEENSIIGNVALYGATSGYCWF
RGVAGERFAVRNSGANAIVEAVGDHGCEYMTGGRIIVLGTIGRNFAAAMSGGIAYLFAQE
DNFSRLINSATVDLDDATTEDLIFVKTKIEEFVKLTGSELGQRILDNWQREHLKIIKVFP
RDYKRVLAEEEEQRKKQAEIDKANQDMSLLSVDDSKPRTRTLSMDMQIAPTIRQHHKKTK
VAPRKKSLLGDNRKQRRLSKSLRPQDFAGFENEEDLQEAADLEEEEDNKSDLEDHSDEEE
YVEKKPSFDIETLAVPPNLRKKDEPLDKLHGFVKYKRQTKIYRDPKVRVNDWDEVYDFEA
IRSNIREQAARCMDCGVPFCQGHSGCPLGNIIPKWNDFVFKKNWRQALEQLLQTNNFPEF
TGRVCPAPCEGACTLGIGSPAVTIKSIECAIIDYAFMQGWMKPCKPAFNTGKRIAIIGSG
PSGLGAAAQLIKVGHTVVVYERKNRVGGLLRSAFYFNLNNFYSIFCRYGIPTMKLDKFVV
DRRVTLLEQEGVRFLTNTEIGKHVPADFLLKENDAIIVCTGSTTARDLIVEGREAKGICF
AMEYLERSQRRRAGDEIGWEGLDPANKKVIVLGGGDTATDCIATANRLGCKSVGAFEILP
MPGATRKPENPWPEWPLIFRVDYGHDEAKEKTGSDPRTYSVSTKRFLTTTNSAGVKVLTG
LEIVNVEWEKDEKGAWKLVELTETLRTIECDLCILAMGFVGPEKTVIEQLNLKTDPRSNI
LTPKDKYDSDVAKVFAAGDCRRGQSLVVWAIHEGRQAARQVDEYLMGKTTLAGPGGIVTA
TIQQKNAI
Download sequence
Identical sequences 281687.CJA02190 CJA02190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]