SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA02561 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA02561
Domain Number 1 Region: 18-282
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.36e-39
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 265-330
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.64e-17
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA02561   Protein: JA33190   Gene: WBGene00121765
Sequence length 437
Comment JA33190 WBGene00121765 status:Partially_confirmed
Sequence
MIWVLFSVAIMTTCLSAEPTVVVVGGGLAGLSASLQIISDGGRVILVEGEGNTGGNSAKA
SSGINGAGTETQKNMGITDSPDLLQKDTLTAGDDENDKKLVEILAANSADAVQFLKNVGV
DLTDVNLCGGHSVPRTHWIPSPKEGRPIPAGFEIMKRLRTRLNEIQEKDPEAFRLLTQTK
MIGIEKRDGRVVGIQTESVADGSKSSVFGNAVVLATGGFSADRSENGLLVEFGGEKLGFP
STNGPFARGDGVKVARSIGAKIIGMDRIQIHPTAFVDPKEPGAGTKFLAAEALRGKGAIL
INSDGKRFGNELGRRDYLTGRILEHAKPIEEKFQGGSAGKPSAIMLMNEANVDAFGRPAF
NFYAIVKKFFSEFWDGCSQLLQEWSPEHFFLLYSQNTVRECIINLAIAIRHFSIRKSAAR
IRGDINSTLYNGCIKCA
Download sequence
Identical sequences 281687.CJA02561 CJA02561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]