SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA02576 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA02576
Domain Number 1 Region: 18-47,110-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-26
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 221-304
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.55e-20
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Weak hits

Sequence:  CJA02576
Domain Number - Region: 299-338
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0153
Family Tetracyclin repressor-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA02576   Protein: JA10425   Gene: WBGene00121780
Sequence length 460
Comment JA10425 WBGene00121780 locus:Cjp-twk-18 status:Partially_confirmed
Sequence
MAIVAQGVSSIVTTFQKTFKGLLPLIILVIYTLLGAWIFWMIEGDNEREMLIEQQKERDD
LIRRTVYKINQLQIKRQRRLMTAEEEYNRTAKVLTTFQETLGIVPPDLDKDVHWTFLGSI
FYCMTVYTTIGYGNIVPGTGWGRLATIIYAFLGIPLTVLSLYCLGSLFAKGCKLVWKFFL
RSTRVVSKDLSNKISEAADNIEEGTTAIAPQAANEDDDLLSFPISGLLIITVIWVIFCAV
LFAFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMPIVGILLLIGLSLVSTVMTLIQQ
QIEALATGMKDNIDQEYARALTEAREEGEVDEHVDPEEDPENNKASFDAVVSRMNWSKRG
LYYLLPDSQKKQLQQHSEKKMGRKSIKVQTDNDLLETLIREEILKAELNNEMHKYTAPRS
SSSHQQPKLVYSDVREKEVPIEVVRVEHYNRGDDYLEHDI
Download sequence
Identical sequences A0A2H2HY05
281687.CJA02576 CJA02576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]