SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA04297 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA04297
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.54e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0023
Further Details:      
 
Domain Number 2 Region: 253-488
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000562
Family FAD/NAD-linked reductases, N-terminal and central domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04297   Protein: JA07147   Gene: WBGene00123500
Sequence length 529
Comment JA07147 WBGene00123500 locus:Cjp-fmo-2 status:Predicted
Sequence
MVNKKVAVIGSGASGLPSIRHGLLYGADVTCFEASDDVGGLWRYKSHETNESSVMKTTVI
NTSKEMTSYSDFPPKENLANFMHNTEMLNYLKGYAEHHGLMKHIKLRHKVLNVERSKNYD
NDGTWKITYETPEGKTQEEIFDGVLVCSGHHAIPHWPTPFPGQDKFKGRIVHSHSYKDHK
GYEDKVVVVVGVGNSGIDVAVEQSRIAKQVYLVTRRGTWLMPKLETRGLPFDVLMNTRFF
SLYKLLPQGLLNSIIEYRINQRVDHDLYGIKPSHRVFSAHPSLNDELPNRIANGTVRIKP
NIKKFDGYALHFEDGTIVPHVDEVVMSTGFSFEFDLVEHGKLVPVTENEVDLFKYMFPVA
TSDHNSLCIIGLIQPFGSIMPVSEQQARVFFANLFSGNKIIPTKAQLTADIENKKEEMAK
QFVKSRRHTIQVDYIPYMDELAQLIGCQVPILKTLLTDPLLGLRLFFGPNAGYCYRLAGP
HTWSGARQAIMTIDKRVRQATTSKPEPKNYTIPLLISTLILLAIIYFSL
Download sequence
Identical sequences 281687.CJA04297 CJA04297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]