SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA04840 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA04840
Domain Number - Region: 143-230
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0523
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04840   Protein: JA29534   Gene: WBGene00124044
Sequence length 278
Comment JA29534 WBGene00124044 status:Predicted
Sequence
MNAFFEYFDENGLPPQKANSKRVRFDLDKKSKSQLADEDGGDEDEKTKVKVATIKIDDDE
DDEKRRMDRKKRTQEDMVADFVKILEQMMATIKIDDDEDDEKRRMDRKKRTQEDMVADFV
KILEQMMNPRQAVTAIVSAGMGVAAITVSLIFFGSLPESALNSKQLIIILAVYGILQIVL
ATAFFITCMQTTIAVSKGVKDAFQIVIGLLVALVYVAVTLISLAVGIFGFYKTLCIVSFV
EYEDVDSQFFCPPPVFYTSLTVFILHIVLIVAKCCCCK
Download sequence
Identical sequences 281687.CJA04840 CJA04840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]