SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA05152 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05152
Domain Number 1 Region: 31-427,641-681
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.23e-33
Family FAD-linked reductases, N-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05152   Protein: JA29721   Gene: WBGene00124356
Sequence length 913
Comment JA29721 WBGene00124356 locus:Cjp-amx-2 status:Predicted
Sequence
MAILFFGGADTLKPKTAKQQQRQVNSNQQTPTYDVIVVGAGLTGLTAARKIQQTRPGLSV
LVLEARGQVGGKVRYATMQTRNGVEFVDTGSQFIAPTDSELLSLLQELNVQTSQQLACGN
NTVFEQTKKKRYMLSRTNKWAGFRFRVSCVVCSSDAAYWRLRRHIHLYTLCFGRFLSSVA
QSVVRLNTNPNVTGSCFVHCIFLQKGECGHTQTLRHATTQTQPCLKRRRQKKTQYFRDLS
LQQQWSTTPFSDFVNSESLVGSLTNVSIATMSRGADVTDTDSVNRLMQTFFDAPGEQVSS
VQLALTCASQNATTIEILRRFGHGESLLAKGGMNEVVRRLADGLLIEYSQRVVHVNDAVF
PSIVQTSAGRNFTARQVILATPISTLDNIDIVPAPEASFQQLIQNYGPTGHAYYFTMSFQ
RATWRLNGRSGKVIYTSSSGPLQRVAMSRIHNNNQKIHDLLLENSTSASSSLWGIAHFSY
DVPFETRSKLYTQAIMYSLRFADFSPLDVSIMKLFFHSKIYFFRFFFCFFGFFFGGEKKF
RFLGKNLFSICSELTKTSNFQQKLGKFLFNWQKYVFFLSFLKTKKIFFFFFFFLGEFFLV
MVLKISMNFDVNFATDDLAKGTIPTLRVNIPFESLKYLNDFHTVYQNVHIATADLASKSL
GTMNGAVHSAQAVSNYVLQMLSAAEAQSNGILRDVPVESTTPYVYHTSSHYPPLVLAGSQ
GSTTFHYETSSHYPPTVAAASGAQATTTMKHFSFGNLDSENSTNDEPTAVLYDSPAQQQQ
ATRLQNSSASTPFAYSTSSVMPPVQPIETTTFTHFSNGNAEKSTPTAVQRDDPSVSITQQ
TNGYVYSTSTHYPLVIAGRNLDKNGIDTSATPSPQVVNELQQVSENASNSTALQLARHLN
QLVHSLLTQLQLN
Download sequence
Identical sequences CJA05152 281687.CJA05152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]