SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA05229 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05229
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000131
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05229   Protein: JA06404   Gene: WBGene00124433
Sequence length 131
Comment JA06404 WBGene00124433 status:Partially_confirmed
Sequence
MSHGNGIADIYRSVIVDVINHMKEAFLDENIDIDVLSQLKKEWEDKVNSSGCVDLDSNSA
PPAPRQHVPQQAVRPNPIPQQRMPMGGNVQVQQQQQQQPNRATMAALQAAQMGEAPLRMA
YTAPGVSNFLF
Download sequence
Identical sequences 281687.CJA05229 CJA05229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]