SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA06878 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06878
Domain Number 1 Region: 1-211
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0077
Further Details:      
 
Domain Number 2 Region: 254-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06878   Protein: JA18281   Gene: WBGene00126082
Sequence length 569
Comment JA18281 WBGene00126082 locus:Cjp-fmo-4 status:Partially_confirmed
Sequence
MRVCVVGAGASGLPAIKACLEEGLDVVCFEKSADIGGLWNYRPNQKSIGGTVMESTVVNT
SKEMMAYSDFPPPAEYANFMHHTKVIEYIKDYAKHYGLVEKIRFNTTVKRISRNADDGKY
LVSLESGEIEEFDKLMLCTGHHAQPSYPELKNLDKFKGQVKHAYDYTNPSGYEGKDVFLL
GIGNSALDIAVDIAKIAKSVTISTRRGTWIFNRVSQGGMPYDVQLFSRYYDVLLKTVPWT
LANDFMEHRLQQRMDHDIYGLRPDHRFFQQHPTVNDALANLLCAGYITVTEDIDTFTEDS
VIVKGGREFKCDVFVTCTGYTFDFPFVDSEIVDIKNQQVPLYKYVFPTNSDSVAVIGLIQ
PIGSIAPISEIQSRWAARVFAGRCALPSSKQQILDVVQKKEDMKRRYFDSIKHTIQVDYM
TYMDEIAEIIGCLPPMKQYLMSHPRFWMKLFMGPNVPYVYRLVGPHAWDGAEQAIWTVPE
RVKKPLKNRQCRTRKHKKRGTTDEYFRYATQKVIATNISILFCSGLLLYCSATATLPPAI
YFLSFFLFFTLYGATLMWFDLQYDMTTII
Download sequence
Identical sequences A0A2H2I4M4
CJA06878 281687.CJA06878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]