SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA07567 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07567
Domain Number 1 Region: 1-110,144-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.39e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07567   Protein: JA37036   Gene: WBGene00126771
Sequence length 266
Comment JA37036 WBGene00126771 status:Partially_confirmed
Sequence
MKFVVVGSGIAGVSCSNEMLKLDRNPDLEIVLISASSFVKSVENYRITGQYCESFDVKET
EHHSELFPDKRFRFVNDKVINWDANRKELILEQQGCMKYDKLCIATGSRPKLQDEFGHDA
RFIFLRDTQSAEHLKQKELRPDTIIWAGGVVPNSEIWTKSGLKVGENGGITVNDACETPL
PDVFACGDVCSVSLPNPSYLWNQRQLWTQARQQGEVCGRSMVAGAEEARMQNMYFELFSH
CTSFFGLKVRLRDHWIQTSFPNTHDR
Download sequence
Identical sequences 281687.CJA07567 CJA07567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]