SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA07731 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07731
Domain Number 1 Region: 22-330,454-493
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.4e-54
Family FAD-linked reductases, N-terminal domain 0.007
Further Details:      
 
Domain Number 2 Region: 311-434
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.81e-18
Family L-aminoacid/polyamine oxidase 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07731   Protein: JA33580   Gene: WBGene00126935
Sequence length 502
Comment JA33580 WBGene00126935 locus:Cjp-amx-3 status:Partially_confirmed
Sequence
MGYGRTHFKCAKKCAPRYFNPHLKVAIIGAGLAGLRAAQCFEHANVDYIVYEGSDRVGGR
VYPFAYKNGYLHYGAEYVNGTDNEIYQIVEKHDLLHKPESRTGDLWMLDEGTITVVDGKR
VEGAVLQVWKDFVQNCNDALNEEANIRREWTRSVAEKIDTHLGTFLESYSHSNNWSENDS
ADLKKLCAVFKNYFQTEWSSPADELGMKNLYTWTDGTDVEDSAVLNEFGFQRILEEFKKP
ISNEKIRLNSKVVNIRYGDGDGVWITLENGEREFHEAVIVTCSLGYLKRYKKDLFSPPLQ
SHKDEAIARMGFGSNMKVFLEYEQAWWPQTTSTIIAVSENEEPDDKLKDNLMVFQPSSWA
HNVSDFYCWMILVAWIAGCGPHEVAQRSDTELKTIIDEHLKKNLNGLFHVENSTRIFRHD
WINDQFALGSYSYFTPEIENENENNDCIEVLGEPIMFNKRPVICFAGEHTDPEIYQTTIG
AARSGYREAARITLHYTRAVAN
Download sequence
Identical sequences 281687.CJA07731 CJA07731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]